LXL04_027682 | RubberDandelionOmics

Gene overview

LXL04_027682

Reference: OH-1004 Chr: Chr06 Coordinates: 21720576-21720809 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

234 bp · LXL04_027682|LXL04_027682|OH1004|cDNA

ATGGGTACAAACTTTGAGTTCGTCCCATTTGGATCAGGAAGGAGAATGTGCCCTGGGATAAATTTTGGTGTGACTTCTATTGAGTTTGCTCTTGCTCAAATGCTTTACTACTTCAATTGGCAACTTCCTTCCGAATTAACTCCAAAGGATATCGACATGACAGAGGATGATGGACTATTAGCAGTAAAGAAAGTTCCATTGGCTGCAACGCCAACTCTTCATTCTTCATTATAA

CDS

Download CDS FASTA

234 bp · LXL04_027682|LXL04_027682|OH1004|CDS

ATGGGTACAAACTTTGAGTTCGTCCCATTTGGATCAGGAAGGAGAATGTGCCCTGGGATAAATTTTGGTGTGACTTCTATTGAGTTTGCTCTTGCTCAAATGCTTTACTACTTCAATTGGCAACTTCCTTCCGAATTAACTCCAAAGGATATCGACATGACAGAGGATGATGGACTATTAGCAGTAAAGAAAGTTCCATTGGCTGCAACGCCAACTCTTCATTCTTCATTATAA

Protein

Download Protein FASTA

77 aa · LXL04_027682|LXL04_027682|OH1004|PROTEIN

MGTNFEFVPFGSGRRMCPGINFGVTSIEFALAQMLYYFNWQLPSELTPKDIDMTEDDGLLAVKKVPLAATPTLHSSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027682`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027682

Location Chr06:21720576-21720809 (-)

Description Similar to Cytochrome P450 Tp9025

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0570500`	Enzyme of the diterpenoid metabolism involved in the biosynthesis of antibacterial oryzalides such as phytocassane.	Parsing a multifunctional biosynthetic gene cluster from rice: Biochemical characterization of CYP71Z6 & 7.2011 · DOI: 10.1016/j.febslet.2011.09.038

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027682 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0009625 response to insect Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010225 response to UV-C Biological Process

GO:0016102 diterpenoid biosynthetic process Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0051762 sesquiterpene biosynthetic process Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

KEGG gene cross-reference

ag:AAT39473

dosa:Os02g0570500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.515

Rank 1 · LXL04_027682 · OH-1004

Cytoplasm0.102

Rank 2 · LXL04_027682 · OH-1004

Plastid0.091

Rank 3 · LXL04_027682 · OH-1004

Peroxisome0.065

Rank 4 · LXL04_027682 · OH-1004

Nucleus0.043

Rank 5 · LXL04_027682 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p4504-60 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027682	`PF00067.28`	p450	4	60	5.8e-12	45.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A3A871`	Oryza sativa subsp. japonica	Ent-isokaurene C2/C3-hydroxylase	54.795%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card