LXL04_027655 | RubberDandelionOmics

Gene overview

LXL04_027655

Reference: OH-1004 Chr: Chr06 Coordinates: 21247453-21248250 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · LXL04_027655|LXL04_027655|OH1004|cDNA

ATGGTGGTTAAGGTGTACGGAGCCCCGTTCCCTCATCCAAAACGAGTCCTGGTTTGTCTTGCCGAAAAAGAAATCGAGTTCGAGATGATTTTCGTCGATCTATTCAAACAGGAACATCACACTCCTAAATTCCTGAAATTACAGCCGTTTCGCTACGTTCCTATAATCCAAGATGGCGATTACACCCTCTACGAATCACGAGCAATCATCCGCTATTATGCGAAGAAGTACAGGTCGCAAGGAACTGATTTACTCGGGAA...

CDS

Download CDS FASTA

648 bp · LXL04_027655|LXL04_027655|OH1004|CDS

ATGGTGGTTAAGGTGTACGGAGCCCCGTTCCCTCATCCAAAACGAGTCCTGGTTTGTCTTGCCGAAAAAGAAATCGAGTTCGAGATGATTTTCGTCGATCTATTCAAACAGGAACATCACACTCCTAAATTCCTGAAATTACAGCCGTTTCGCTACGTTCCTATAATCCAAGATGGCGATTACACCCTCTACGAATCACGAGCAATCATCCGCTATTATGCGAAGAAGTACAGGTCGCAAGGAACTGATTTACTCGGGAA...

Protein

Download Protein FASTA

215 aa · LXL04_027655|LXL04_027655|OH1004|PROTEIN

MVVKVYGAPFPHPKRVLVCLAEKEIEFEMIFVDLFKQEHHTPKFLKLQPFRYVPIIQDGDYTLYESRAIIRYYAKKYRSQGTDLLGKTMEEEGLVNQWLEVEATRFHPPVFHLVTQIMFGPEFGIERSEKVVKENEEALGKVLDVYEDRLSKSKYLAGDFFSLADLAHLPFGENLVGPCGKEYMIKERKHVSAWWDDISSRPSWKKVNEACKTLE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027655`
TK1151 ID	TkA07G083710
OH-1004 ID	LXL04_027655
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027655

Location Chr06:21247453-21248250 (+)

Description Similar to GSTF9: Glutathione S-transferase F9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30860`	In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC), and glutathione peroxidase activity toward cumene hydroperoxide and linoleic acid-13-hydroperoxide.	Probing the diversity of the Arabidopsis glutathione S-transferase gene family.2002 · DOI: 10.1023/a:1015557300450 Characterization of two Arabidopsis thaliana glutathione S-transferases.2006 · DOI: 10.1007/s00299-006-0146-1
`At2g30870`	In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC).	Probing the diversity of the Arabidopsis glutathione S-transferase gene family.2002 · DOI: 10.1023/a:1015557300450
`At3g03190`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At5g17220`	Involved in the transport and/or accumulation of both anthocyanins and proanthocyanidins (PA)s in the vacuole.	TRANSPARENT TESTA 19 is involved in the accumulation of both anthocyanins and proanthocyanidins in Arabidopsis.2004 · DOI: 10.1046/j.1365-313x.2003.01943.x The Arabidopsis tt19-4 mutant differentially accumulates proanthocyanidin and anthocyanin through a 3' amino acid substitution in glutathione S-transferase.2011 · DOI: 10.1111/j.1365-3040.2010.02249.x
`At3g62760`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027655 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0046283 anthocyanin-containing compound metabolic process Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:1900384 regulation of flavonol biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G30860

ath:AT2G30870

ath:AT3G03190

ath:AT3G62760

ath:AT5G17220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.807

Rank 1 · LXL04_027655 · OH-1004

Nucleus0.207

Rank 2 · LXL04_027655 · OH-1004

Mitochondrion0.073

Rank 3 · LXL04_027655 · OH-1004

Endoplasmic reticulum0.063

Rank 4 · LXL04_027655 · OH-1004

Peroxisome0.055

Rank 5 · LXL04_027655 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798.27GST_N1-73 aa

PF13417.13GST_N_36-78 aa

PF13409.13GST_N_211-75 aa

PF00043.31GST_C107-202 aa

PF14497.12GST_C_3130-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027655	`PF02798.27`	GST_N	1	73	1.2e-15	58.3
LXL04_027655	`PF13417.13`	GST_N_3	6	78	5e-10	40.3
LXL04_027655	`PF13409.13`	GST_N_2	11	75	8.6e-13	49.4
LXL04_027655	`PF00043.31`	GST_C	107	202	2.4e-15	57.2
LXL04_027655	`PF14497.12`	GST_C_3	130	205	2.7e-06	28.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80852`	Arabidopsis thaliana	Glutathione S-transferase F9	64.734%	Swiss-Prot	strong database homology
`P42761`	Arabidopsis thaliana	Glutathione S-transferase F10	59.615%	Swiss-Prot	strong database homology
`Q96324`	Arabidopsis thaliana	Glutathione S-transferase F11	48.095%	Swiss-Prot	moderate database homology
`Q9FE46`	Arabidopsis thaliana	Glutathione S-transferase F12	45.192%	Swiss-Prot	moderate database homology
`Q9LZI9`	Arabidopsis thaliana	Glutathione S-transferase F13	44.762%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card