LXL04_027653 | RubberDandelionOmics

Gene overview

LXL04_027653

Reference: OH-1004 Chr: Chr06 Coordinates: 21142404-21143924 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1521 bp · LXL04_027653|LXL04_027653|OH1004|cDNA

ATGGGGTCTCTTTCTGCCATAGTCGTATGGCTAGCTCCATACATTCTATCCATGGCTGCATTTCTGATTTTCTTGGAGCAAATCAATTACTTGAAGAAGAAACGCTTCGTCCCTGGCCCGGGTCTGGTGTTGCCGTTCATCGGCAACGCAATTTCACTCGTCCGGAATCCCACAGAGTTCTGGGACCTTCAGTCCGCCATGGCGAAATCCTCCGACATGGGATTTTCCGTAAATTATATAATCGGAAGATTCATCGTCTT...

CDS

Download CDS FASTA

1521 bp · LXL04_027653|LXL04_027653|OH1004|CDS

ATGGGGTCTCTTTCTGCCATAGTCGTATGGCTAGCTCCATACATTCTATCCATGGCTGCATTTCTGATTTTCTTGGAGCAAATCAATTACTTGAAGAAGAAACGCTTCGTCCCTGGCCCGGGTCTGGTGTTGCCGTTCATCGGCAACGCAATTTCACTCGTCCGGAATCCCACAGAGTTCTGGGACCTTCAGTCCGCCATGGCGAAATCCTCCGACATGGGATTTTCCGTAAATTATATAATCGGAAGATTCATCGTCTT...

Protein

Download Protein FASTA

506 aa · LXL04_027653|LXL04_027653|OH1004|PROTEIN

MGSLSAIVVWLAPYILSMAAFLIFLEQINYLKKKRFVPGPGLVLPFIGNAISLVRNPTEFWDLQSAMAKSSDMGFSVNYIIGRFIVFIRSTDLSHKVFANVRPDAFHLVGHPFGKKLFGEHNLIYMMGQEHKDLRRRIAPNFTPKALSTYTELQQYIILKHLKSWMESSESNTKPFPLRLLCRDMNLETSQNVFVGPYLSGESRTRFEVDYNFFNVGLMKLPIDLPGTAFRNARLAVSRLVETLAVCAEDSKTKMKTGDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027653`
TK1151 ID	TkA07G083480
OH-1004 ID	LXL04_027653
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	77.800
Protein coverage (%)	TK1151 100.000 / OH-1004 49.802 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027653

Location Chr06:21142404-21143924 (+)

Description Similar to CYP710A11: Cytochrome P450 710A11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34500`	Required to form the C-22 double bond in the sterol side chain.	Cytochrome P450 CYP710A encodes the sterol C-22 desaturase in Arabidopsis and tomato.2006 · DOI: 10.1105/tpc.105.036012 Overexpression of CYP710A1 and CYP710A4 in transgenic Arabidopsis plants increases the level of stigmasterol at the expense of sitosterol.2008 · DOI: 10.1007/s00425-007-0618-8 A role for beta-sitosterol to stigmasterol conversion in plant-pathogen interactions.2010 · DOI: 10.1111/j.1365-313x.2010.04235.x
`At2g34490`	Required to form the C-22 double bond in the sterol side chain.	Cytochrome P450 CYP710A encodes the sterol C-22 desaturase in Arabidopsis and tomato.2006 · DOI: 10.1105/tpc.105.036012
`At2g28850`	Required to form the C-22 double bond in the sterol side chain.	No verified direct reference in this release
`At2g28860`	Required to form the C-22 double bond in the sterol side chain.	Overexpression of CYP710A1 and CYP710A4 in transgenic Arabidopsis plants increases the level of stigmasterol at the expense of sitosterol.2008 · DOI: 10.1007/s00425-007-0618-8

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027653 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016126 sterol biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

GO:0000249 C-22 sterol desaturase (NADPH) activity Molecular Function

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT2G28850

ath:AT2G28860

ath:AT2G34490

ath:AT2G34500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.818

Rank 1 · LXL04_027653 · OH-1004

Cytoplasm0.065

Rank 2 · LXL04_027653 · OH-1004

Mitochondrion0.052

Rank 3 · LXL04_027653 · OH-1004

Plastid0.049

Rank 4 · LXL04_027653 · OH-1004

Golgi apparatus0.045

Rank 5 · LXL04_027653 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45038-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027653	`PF00067.28`	p450	38	473	3.5e-49	168.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64697`	Arabidopsis thaliana	Cytochrome P450 710A1	65.408%	Swiss-Prot	strong database homology
`O64698`	Arabidopsis thaliana	Cytochrome P450 710A2	63.000%	Swiss-Prot	strong database homology
`Q9ZV29`	Arabidopsis thaliana	Cytochrome P450 710A3	59.639%	Swiss-Prot	strong database homology
`Q9ZV28`	Arabidopsis thaliana	Cytochrome P450 710A4	58.233%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card