RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_027647
Reference: OH-1004 Chr: Chr06 Coordinates: 21002522-21003661 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

897 bp · LXL04_027647|LXL04_027647|OH1004|cDNA

ATGAGAAAATCATTGAAGCGGCCAGGGTTCCGTTTTAAACCTACTGATGTTGAATTGGCTATGTATTACCTCAAGAAAAAGTTACTAAACATAAAGCTTGACCCCGAAGTTATTGCAGAAATTAATATAAACGATTTCAGCCCATGGGATCTTCCAGCCAAATCCATCTTAAGTGGTGATCTAGAATGGTACTTTTTTTCCCCAAAACCTAAAAAGTACTTAAGTGGGCCCAGAATGAACCGGGCAACTAAAACCGGTCA...

CDS

Download CDS FASTA

897 bp · LXL04_027647|LXL04_027647|OH1004|CDS

ATGAGAAAATCATTGAAGCGGCCAGGGTTCCGTTTTAAACCTACTGATGTTGAATTGGCTATGTATTACCTCAAGAAAAAGTTACTAAACATAAAGCTTGACCCCGAAGTTATTGCAGAAATTAATATAAACGATTTCAGCCCATGGGATCTTCCAGCCAAATCCATCTTAAGTGGTGATCTAGAATGGTACTTTTTTTCCCCAAAACCTAAAAAGTACTTAAGTGGGCCCAGAATGAACCGGGCAACTAAAACCGGTCA...

Protein

Download Protein FASTA

298 aa · LXL04_027647|LXL04_027647|OH1004|PROTEIN

MRKSLKRPGFRFKPTDVELAMYYLKKKLLNIKLDPEVIAEININDFSPWDLPAKSILSGDLEWYFFSPKPKKYLSGPRMNRATKTGHWKGTGKDKEVKHKGKTVAMRKTLIFYMGHPPKWTRTNWVMHEYRMKDEDLANQGVCQDAYMVCRVFEKSDVGPKNGAQYGGQFEEDDDDDEGSSVTSVMMVGVLVNPNNASTSGAGPSTITSLENEKPTDVLVNDDVMLTRGDLSSIRNKDTQKAYKEVEDGKGKKVMSDDGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_027647
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_027647
LocationChr06:21002522-21003661 (+)
DescriptionSimilar to NAC078: NAC domain-containing protein 78
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g04410 Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). No verified direct reference in this release
At5g09330 Transcriptional regulator that binds specific DNA sequences on the promoter regions of target genes. No verified direct reference in this release
At3g10500 Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP).
A NAC transcription factor NTL4 promotes reactive oxygen species production during drought-induced leaf senescence in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.04932.x
The Arabidopsis NAC transcription factor NTL4 participates in a positive feedback loop that induces programmed cell death under heat stress conditions.2014 · DOI: 10.1016/j.plantsci.2014.07.003
At3g10490 Transcriptional repressor that binds to the motif 5'- (C/T)A(C/A)G-3' in the promoter of target genes.
Two novel NAC transcription factors regulate gene expression and flowering time by associating with the histone demethylase JMJ14.2015 · DOI: 10.1093/nar/gku1382
C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.2015 · DOI: 10.1038/celldisc.2015.3

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0119966 Transcription factor that functions as a regulator of the jasmonate (JA) signaling pathway.
Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus.2009 · DOI: 10.1111/j.1365-313x.2008.03712.x
The NAC transcription factor RIM1 of rice is a new regulator of jasmonate signaling.2010 · DOI: 10.1111/j.1365-313x.2009.04107.x
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027647 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0002237 response to molecule of bacterial origin Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006952 defense response Biological Process
GO:0009555 pollen development Biological Process
GO:0009644 response to high light intensity Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009819 drought recovery Biological Process
GO:0009908 flower development Biological Process
GO:0009962 regulation of flavonoid biosynthetic process Biological Process
GO:0010150 leaf senescence Biological Process
KEGG gene cross-reference
ath:AT3G10490
ath:AT3G10500
ath:AT5G04410
ath:AT5G09330
dosa:Os03g0119966
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961
Rank 1 · LXL04_027647 · OH-1004
Cytoplasm0.096
Rank 2 · LXL04_027647 · OH-1004
Cell membrane0.037
Rank 3 · LXL04_027647 · OH-1004
Endoplasmic reticulum0.029
Rank 4 · LXL04_027647 · OH-1004
Plastid0.012
Rank 5 · LXL04_027647 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM8-132 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_027647PF02365.21NAM81325.3e-40137.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q84K00Arabidopsis thalianaNAC domain-containing protein 7853.179%Swiss-Protmoderate database homology
Q9FY82Arabidopsis thalianaNAC domain-containing protein 8249.010%Swiss-Protmoderate database homology
Q949N0Arabidopsis thalianaNAC domain-containing protein 5354.878%Swiss-Protmoderate database homology
Q9SQY0Arabidopsis thalianaNAC domain containing protein 5248.333%Swiss-Protmoderate database homology
Q8H045Oryza sativa subsp. japonicaNAC domain-containing protein 5452.174%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser