LXL04_027637 | RubberDandelionOmics

Gene overview

LXL04_027637

Reference: OH-1004 Chr: Chr06 Coordinates: 20848790-20850046 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · LXL04_027637|LXL04_027637|OH1004|cDNA

ATGCTAACTTTAACACACACTTTGTTCACTTCCActtccacctccacctcctCATCCTCAACCCTTCTATGTCGCCACAAACCCCACATTCACTCTCTCAATTCTCATCGCTCCGCCCACCTCCATACTCCTACTTCTCTCCAGCTCTTTAACCCTCTAAGAAGTTTCGTCCAAAATAGAGGTAAATTGGGGATGAACCAGAAATTGAAACGAGGGTTTGGCACAGTTTGCTATGCTGCTCCAATTACTACGACTAACCT...

CDS

Download CDS FASTA

684 bp · LXL04_027637|LXL04_027637|OH1004|CDS

ATGCTAACTTTAACACACACTTTGTTCACTTCCACTTCCACCTCCACCTCCTCATCCTCAACCCTTCTATGTCGCCACAAACCCCACATTCACTCTCTCAATTCTCATCGCTCCGCCCACCTCCATACTCCTACTTCTCTCCAGCTCTTTAACCCTCTAAGAAGTTTCGTCCAAAATAGAGGTAAATTGGGGATGAACCAGAAATTGAAACGAGGGTTTGGCACAGTTTGCTATGCTGCTCCAATTACTACGACTAACCT...

Protein

Download Protein FASTA

227 aa · LXL04_027637|LXL04_027637|OH1004|PROTEIN

MLTLTHTLFTSTSTSTSSSSTLLCRHKPHIHSLNSHRSAHLHTPTSLQLFNPLRSFVQNRGKLGMNQKLKRGFGTVCYAAPITTTNLQWICTVSAAVLMVVKGTPIQKSFLVPFFALQAPASLTSWIKGEYGIWTAFLALLVRLFFYIPGELELPFIAWLLVIVSPYQIANLRGRQEGIVISLVIAAFIAFQHFTRVGSLRRAFDQGSIIATLAISSIVAVPCLLLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027637`
TK1151 ID	TkA07G082110
OH-1004 ID	LXL04_027637
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027637

Location Chr06:20848790-20850046 (+)

Description Similar to COR413IM1: Cold-regulated 413 inner membrane protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29395`	Cold-regulated 413 inner membrane protein 1, chloroplastic.	No verified direct reference in this release
`At1g29390`	Cold-regulated 413 inner membrane protein 2, chloroplastic.	No verified direct reference in this release
`At4g37220`	Cold-regulated 413 plasma membrane protein 4.	No verified direct reference in this release
`At3g50830`	Cold-regulated 413 plasma membrane protein 2.	No verified direct reference in this release
`At2g15970`	Cold-regulated 413 plasma membrane protein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027637 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009631 cold acclimation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009750 response to fructose Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT1G29390

ath:AT1G29395

ath:AT2G15970

ath:AT3G50830

ath:AT4G37220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_027637 · OH-1004

Nucleus0.019

Rank 2 · LXL04_027637 · OH-1004

Mitochondrion0.019

Rank 3 · LXL04_027637 · OH-1004

Cytoplasm0.011

Rank 4 · LXL04_027637 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_027637 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05562.17WCOR41367-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027637	`PF05562.17`	WCOR413	67	215	8.1e-49	166.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AL8`	Arabidopsis thaliana	Cold-regulated 413 inner membrane protein 1, chloroplastic	54.945%	Swiss-Prot	strong database homology
`F4I1G5`	Arabidopsis thaliana	Cold-regulated 413 inner membrane protein 2, chloroplastic	55.556%	Swiss-Prot	strong database homology
`O23164`	Arabidopsis thaliana	Cold-regulated 413 plasma membrane protein 4	29.592%	Swiss-Prot	weak database homology
`Q9SVL6`	Arabidopsis thaliana	Cold-regulated 413 plasma membrane protein 2	32.215%	Swiss-Prot	moderate database homology
`Q9XIM7`	Arabidopsis thaliana	Cold-regulated 413 plasma membrane protein 1	31.333%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card