Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2379 bp · LXL04_027634|LXL04_027634|OH1004|cDNA
ATGGAGTTGGAGCTATTGGCCAGCGCTGCCGAAAGTATATCCCCCATGGAAAGGTTTGACTGTAATGCCTTAATTGTTTTAGCAGTTGGTTCGTCTGAAGAAGTGTATAAAACTGTTGATGATGGCCCGTTAGACTTTGATTCTTGGACTTCACTCATTTCAAAGATTGAGAAAAACTACCAGGAAAACATAAAGGCAATATCATGGGTGTATGAGTCATTCCTCTCTCGGTTTCCATTGTGTCATGAATATTGGAAGAG...
2379 bp · LXL04_027634|LXL04_027634|OH1004|CDS
ATGGAGTTGGAGCTATTGGCCAGCGCTGCCGAAAGTATATCCCCCATGGAAAGGTTTGACTGTAATGCCTTAATTGTTTTAGCAGTTGGTTCGTCTGAAGAAGTGTATAAAACTGTTGATGATGGCCCGTTAGACTTTGATTCTTGGACTTCACTCATTTCAAAGATTGAGAAAAACTACCAGGAAAACATAAAGGCAATATCATGGGTGTATGAGTCATTCCTCTCTCGGTTTCCATTGTGTCATGAATATTGGAAGAG...
Protein
Download Protein FASTA792 aa · LXL04_027634|LXL04_027634|OH1004|PROTEIN
MELELLASAAESISPMERFDCNALIVLAVGSSEEVYKTVDDGPLDFDSWTSLISKIEKNYQENIKAISWVYESFLSRFPLCHEYWKRYADHMARFSTMEKAVEIYESAVESATYSVGFWVDYCSFCMLAFEDPNDVRRVFERGLSYVGKDFLSYKLWDLYIRFELSQQQWSLLAHILIRALKFPTKSLHKYYDNFKEFAAFVEEDMSHSKSRHLEPYEDDSNIEFATSHDKVLYTIKKLQDSSSVELRSKSLNKLINIGE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_027634 |
|---|---|
| TK1151 ID | TkA07G081730 |
| OH-1004 ID | LXL04_027634 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.600 |
| Protein coverage (%) | TK1151 92.810 / OH-1004 35.859Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_027634 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:20747933-20752141 (-) | |||||||||
| Description | Similar to prpf39: Pre-mRNA-processing factor 39 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000395 mRNA 5'-splice site recognition Biological Process GO:0006397 mRNA processing Biological Process GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process GO:0048573 photoperiodism, flowering Biological Process GO:0140727 siRNA-mediated pericentric heterochromatin formation Biological Process GO:0000243 commitment complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005685 U1 snRNP Cellular Component GO:0071004 U2-type prespliceosome Cellular Component GO:0030627 pre-mRNA 5'-splice site binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G04080 ath:AT5G46400 hsa:55015 spo:2540869 xla:734636 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23240.2HAT_PRP39_N34-197 aaPF05843.21Suf35-201 aaPF23233.2HAT_Syf1_CNRKL1_N70-200 aaPF23241.2HAT_PRP39_C83-176 aaPF05843.21Suf260-553 aaPF23241.2HAT_PRP39_C273-411 aaPF23231.2HAT_Syf1_CNRKL1_C297-443 aaPF29376.1PRP6_TPR302-433 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_027634 | PF23240.2 | HAT_PRP39_N | 34 | 197 | 5.9e-55 | 186.6 |
| LXL04_027634 | PF05843.21 | Suf | 35 | 201 | 5.5e-14 | 52.3 |
| LXL04_027634 | PF23233.2 | HAT_Syf1_CNRKL1_N | 70 | 200 | 1.4e-11 | 45.2 |
| LXL04_027634 | PF23241.2 | HAT_PRP39_C | 83 | 176 | 6.3e-47 | 159.9 |
| LXL04_027634 | PF05843.21 | Suf | 260 | 553 | 5.5e-14 | 52.3 |
| LXL04_027634 | PF23241.2 | HAT_PRP39_C | 273 | 411 | 6.3e-47 | 159.9 |
| LXL04_027634 | PF23231.2 | HAT_Syf1_CNRKL1_C | 297 | 443 | 2.3e-09 | 37.2 |
| LXL04_027634 | PF29376.1 | PRP6_TPR | 302 | 433 | 1.3e-07 | 31.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.