Gene Card
Gene overview
cDNA / CDS / Protein Sequences
375 bp · LXL04_027336|LXL04_027336|OH1004|cDNA
ATGGAATCAACAACGGAAATATCCAATCACAATGAAAACCCTCAAATAATTTACCGCTGTAAAAAATGTCGAAGAATTGTTGCTTCAAAAGACCAAATAATTCCACATGAGCCTGGAAATGGACAAAAATGCTTTAAATGGAAGAAAAGAACAGGGGATACAAATACAACAAACGAATGTTCTTCCATATTTGTAGAGCCTATGAAATGGATGCAAGCAGTTGAAGATGGTAACGTGGAACAGAAGCTTCAGTGCATTGG...
375 bp · LXL04_027336|LXL04_027336|OH1004|CDS
ATGGAATCAACAACGGAAATATCCAATCACAATGAAAACCCTCAAATAATTTACCGCTGTAAAAAATGTCGAAGAATTGTTGCTTCAAAAGACCAAATAATTCCACATGAGCCTGGAAATGGACAAAAATGCTTTAAATGGAAGAAAAGAACAGGGGATACAAATACAACAAACGAATGTTCTTCCATATTTGTAGAGCCTATGAAATGGATGCAAGCAGTTGAAGATGGTAACGTGGAACAGAAGCTTCAGTGCATTGG...
Protein
Download Protein FASTA124 aa · LXL04_027336|LXL04_027336|OH1004|PROTEIN
MESTTEISNHNENPQIIYRCKKCRRIVASKDQIIPHEPGNGQKCFKWKKRTGDTNTTNECSSIFVEPMKWMQAVEDGNVEQKLQCIGCNARLGSFNWAGMQCNCGAWVNPAFQLHKSRVDECRV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_027336 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_027336 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr06:13787225-13787672 (+) | ||||||
| Description | Similar to At4g18593: Probable inactive dual specificity protein phosphatase-like At4g18593 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0006470 protein dephosphorylation Biological Process GO:0016311 dephosphorylation Biological Process GO:0023052 signaling Biological Process GO:0036211 protein modification process Biological Process GO:0180023 cytosolic large ribosomal subunit assembly Biological Process GO:1903301 positive regulation of hexokinase activity Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004721 phosphoprotein phosphatase activity Molecular Function GO:0004722 protein serine/threonine phosphatase activity Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT4G18593 hsa:11266 mmu:80915 rno:64014 spo:2540146 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q570P7 | Arabidopsis thaliana | Probable inactive dual specificity protein phosphatase-like At4g18593 | 63.415% | Swiss-Prot | strong database homology |