LXL04_027058 | RubberDandelionOmics

Gene overview

LXL04_027058

Reference: OH-1004 Chr: Chr06 Coordinates: 8012688-8013230 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · LXL04_027058|LXL04_027058|OH1004|cDNA

ATGTATTCCATTCACGGTATTGTCTCTCCCCTAATTCACCTATTCAGACACCTTAAAGCCCTAGATCTCAGTAAATTGAATCACAGTTATCTCGAAACGGCTCTTTACGAGTTCGCTCGTTCTTCCGTTGCCTTGAATTTGGAAATTCTCAACATCTCCAACCACGATTTGATACCAAATCGAGGTTCAAAAGAGCTGAGATTGAGTAATAGGAAAATCAAGGGGAAAGTTGAAGATGTGGAATTGCCCGAAAAAGCTGA...

CDS

Download CDS FASTA

405 bp · LXL04_027058|LXL04_027058|OH1004|CDS

ATGTATTCCATTCACGGTATTGTCTCTCCCCTAATTCACCTATTCAGACACCTTAAAGCCCTAGATCTCAGTAAATTGAATCACAGTTATCTCGAAACGGCTCTTTACGAGTTCGCTCGTTCTTCCGTTGCCTTGAATTTGGAAATTCTCAACATCTCCAACCACGATTTGATACCAAATCGAGGTTCAAAAGAGCTGAGATTGAGTAATAGGAAAATCAAGGGGAAAGTTGAAGATGTGGAATTGCCCGAAAAAGCTGA...

Protein

Download Protein FASTA

134 aa · LXL04_027058|LXL04_027058|OH1004|PROTEIN

MYSIHGIVSPLIHLFRHLKALDLSKLNHSYLETALYEFARSSVALNLEILNISNHDLIPNRGSKELRLSNRKIKGKVEDVELPEKADILISEPMGTLLINERMLESYVIARIDFLFQMGKCSQLLEGGLELFNI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027058`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027058

Location Chr06:8012688-8013230 (+)

Description Similar to PRMT13: Probable histone-arginine methyltransferase 1.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06930`	Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability (By similarity).	PARAQUAT TOLERANCE3 Is an E3 Ligase That Switches off Activated Oxidative Response by Targeting Histone-Modifying PROTEIN METHYLTRANSFERASE4b.2016 · DOI: 10.1371/journal.pgen.1006332
`At5g49020`	Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0671700`	Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability.	No verified direct reference in this release
`UniProt: A2YPT7`	Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027058 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0019919 peptidyl-arginine methylation, to asymmetrical-dimethyl arginine Biological Process

GO:0032259 methylation Biological Process

GO:0033146 regulation of intracellular estrogen receptor signaling pathway Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0046686 response to cadmium ion Biological Process

KEGG gene cross-reference

ath:AT3G06930

ath:AT5G49020

dosa:Os07g0671700

dre:445251

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401

Rank 1 · LXL04_027058 · OH-1004

Nucleus0.274

Rank 2 · LXL04_027058 · OH-1004

Mitochondrion0.135

Rank 3 · LXL04_027058 · OH-1004

Endoplasmic reticulum0.109

Rank 4 · LXL04_027058 · OH-1004

Peroxisome0.091

Rank 5 · LXL04_027058 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W92`	Arabidopsis thaliana	Probable histone-arginine methyltransferase 1.3	83.333%	Swiss-Prot	weak database homology
`A3KPF2`	Arabidopsis thaliana	Probable histone-arginine methyltransferase 1.4	79.167%	Swiss-Prot	weak database homology
`Q7XI75`	Oryza sativa subsp. japonica	Probable histone-arginine methyltransferase CARM1	85.417%	Swiss-Prot	weak database homology
`A2YPT7`	Oryza sativa subsp. indica	Probable histone-arginine methyltransferase CARM1	85.417%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card