LXL04_026939 | RubberDandelionOmics

Gene overview

LXL04_026939

Reference: OH-1004 Chr: Chr06 Coordinates: 5676804-5682717 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1857 bp · LXL04_026939|LXL04_026939|OH1004|cDNA

atgTCGAATTTCTCTCGCCAAATTCAGCTCTCGTCGACTCTAATCAGAGGCGTACAGTATAGAATTTCACGATCATTTACTACAATCGAATGCCATAGACCAACGATTCTTCATAAGAAAGGCGTCGATATTCTTCACAATCCATGGTTTAACAAGGGAACAGCATTCTCCATGACTGAACGAGATCGTCTTGAGCTACGTGGACTTCTCCCTACAAATATCATGACAGCGGAACAACAAATTGAACGATTCCTGACAGA...

CDS

Download CDS FASTA

1857 bp · LXL04_026939|LXL04_026939|OH1004|CDS

ATGTCGAATTTCTCTCGCCAAATTCAGCTCTCGTCGACTCTAATCAGAGGCGTACAGTATAGAATTTCACGATCATTTACTACAATCGAATGCCATAGACCAACGATTCTTCATAAGAAAGGCGTCGATATTCTTCACAATCCATGGTTTAACAAGGGAACAGCATTCTCCATGACTGAACGAGATCGTCTTGAGCTACGTGGACTTCTCCCTACAAATATCATGACAGCGGAACAACAAATTGAACGATTCCTGACAGA...

Protein

Download Protein FASTA

618 aa · LXL04_026939|LXL04_026939|OH1004|PROTEIN

MSNFSRQIQLSSTLIRGVQYRISRSFTTIECHRPTILHKKGVDILHNPWFNKGTAFSMTERDRLELRGLLPTNIMTAEQQIERFLTELKKLEMNTTDGPKDTISLAKWRILNRLHDRNETMYYKILINNIKEYAPIVYTPTVGLVCQKYSGLFRRPRGMYFSADDRGEMMSMVYNWPADQVDMIVVTDGSRIMGLGDLGVQGIGIAIGKLDLYVAAAGINPQRVLPIMLDVGTNNEVLLEDPLYLGLQQHRLEGEEYISI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026939`
TK1151 ID	TkA07G019170
OH-1004 ID	LXL04_026939
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 94.398 / OH-1004 54.531 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026939

Location Chr06:5676804-5682717 (-)

Description Similar to NAD-ME1: NAD-dependent malic enzyme 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g13560`	Involved in the regulation of sugars and amino acids metabolisms during the night period.	Arabidopsis NAD-malic enzyme functions as a homodimer and heterodimer and has a major impact on nocturnal metabolism.2008 · DOI: 10.1104/pp.107.114975
`At4g00570`	Involved in the regulation of sugars and amino acids metabolisms during the night period.	Arabidopsis NAD-malic enzyme functions as a homodimer and heterodimer and has a major impact on nocturnal metabolism.2008 · DOI: 10.1104/pp.107.114975

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026939 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006108 malate metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004471 malate dehydrogenase (decarboxylating) (NAD+) activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050897 cobalt ion binding Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT2G13560

ath:AT4G00570

sot:102598070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.886

Rank 1 · LXL04_026939 · OH-1004

Cytoplasm0.063

Rank 2 · LXL04_026939 · OH-1004

Plastid0.042

Rank 3 · LXL04_026939 · OH-1004

Nucleus0.038

Rank 4 · LXL04_026939 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_026939 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00390.25malic115-295 aa

PF03949.22Malic_M305-573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026939	`PF00390.25`	malic	115	295	7.1e-75	251.5
LXL04_026939	`PF03949.22`	Malic_M	305	573	6.3e-86	288.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIU0`	Arabidopsis thaliana	NAD-dependent malic enzyme 1, mitochondrial	76.975%	Swiss-Prot	strong database homology
`Q8L7K9`	Arabidopsis thaliana	NAD-dependent malic enzyme 2, mitochondrial	62.563%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card