LXL04_026921 | RubberDandelionOmics

Gene overview

LXL04_026921

Reference: OH-1004 Chr: Chr06 Coordinates: 5390043-5392744 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · LXL04_026921|LXL04_026921|OH1004|cDNA

ATGAGGTCACAAGTTAGATTTATTCAAAATTGTGATGGCACCAACCATGCTATTGTTTCATATGTTTTCTGTGGTATTGCTTCCATGGCCAAAgtagaagaaaaaaaagaaacCATCACCATTGCAGTTTATAAAGTTAATCTACATTGCCCAAAATGTGCCCATGATATTAAAAAACCTCTCTTGAGAACCCAAGGAGTCCATAAAGTGGATGTTAAGCATGAAAAAGGTGAAATCAGAGTGGAGGGCTCCATTGAAGT...

CDS

Download CDS FASTA

768 bp · LXL04_026921|LXL04_026921|OH1004|CDS

ATGAGGTCACAAGTTAGATTTATTCAAAATTGTGATGGCACCAACCATGCTATTGTTTCATATGTTTTCTGTGGTATTGCTTCCATGGCCAAAGTAGAAGAAAAAAAAGAAACCATCACCATTGCAGTTTATAAAGTTAATCTACATTGCCCAAAATGTGCCCATGATATTAAAAAACCTCTCTTGAGAACCCAAGGAGTCCATAAAGTGGATGTTAAGCATGAAAAAGGTGAAATCAGAGTGGAGGGCTCCATTGAAGT...

Protein

Download Protein FASTA

255 aa · LXL04_026921|LXL04_026921|OH1004|PROTEIN

MRSQVRFIQNCDGTNHAIVSYVFCGIASMAKVEEKKETITIAVYKVNLHCPKCAHDIKKPLLRTQGVHKVDVKHEKGEIRVEGSIEVKKIHEKLEKWSRKKVEILSQDKKTLEKKETLKKEIIKTTKIKAYMHCEKCEHDLRAKLLKHKGIYNVKTDIKSQTVIIEGVIEAEKIVTYMQKRARKHAEIIPIPPPKEKVEKVETKEKVILSTKIVEFEEKNKVEAKGKDGEAPYFVHYVYAPQMFSDENPNACLVM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026921`
TK1151 ID	TkA07G018300
OH-1004 ID	LXL04_026921
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 95.238 / OH-1004 54.902 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026921

Location Chr06:5390043-5392744 (-)

Description Similar to HIPP04: Heavy metal-associated isoprenylated plant protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29000`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g24580`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g02960`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g60800`	Heavy-metal-binding protein.	The zinc-binding nuclear protein HIPP3 acts as an upstream regulator of the salicylate-dependent plant immunity pathway and of flowering time in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13419
`At5g03380`	Heavy-metal-binding protein.	Functional characterization of a heavy metal binding protein CdI19 from Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01412.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026921 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009910 negative regulation of flower development Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G29000

ath:AT3G02960

ath:AT5G03380

ath:AT5G24580

ath:AT5G60800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.458

Rank 1 · LXL04_026921 · OH-1004

Cytoplasm0.402

Rank 2 · LXL04_026921 · OH-1004

Nucleus0.255

Rank 3 · LXL04_026921 · OH-1004

Endoplasmic reticulum0.058

Rank 4 · LXL04_026921 · OH-1004

Mitochondrion0.039

Rank 5 · LXL04_026921 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403.33HMA44-96 aa

PF00403.33HMA132-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026921	`PF00403.33`	HMA	44	96	4.8e-24	85.2
LXL04_026921	`PF00403.33`	HMA	132	180	4.8e-24	85.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHQ8`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 4	52.096%	Swiss-Prot	moderate database homology
`Q9FLU5`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 9	28.846%	Swiss-Prot	weak database homology
`Q9M8T7`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 8	28.992%	Swiss-Prot	weak database homology
`Q9FJH5`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 3	26.996%	Swiss-Prot	weak database homology
`Q9LZF1`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 6	22.330%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card