LXL04_026902 | RubberDandelionOmics

Gene overview

LXL04_026902

Reference: OH-1004 Chr: Chr06 Coordinates: 5004767-5009496 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2595 bp · LXL04_026902|LXL04_026902|OH1004|cDNA

ATGAACTACGAACAGAGGTTAATCGCCGCCGCGAAGTGCGTATTTGAAGGAGACACCCGCATCGCCGCCGAGGCTCAAGTCAACTGTTCCGACTTCGGTGTAACGGCGACGCTTAAACCTCACCAAATCGAAGGACTGTCATGGCTTATACGCCGATACCTTATCGGTGTCAACGTTATTCTAGGAGATGAGATGGGACTTGGAAAGACATTACAAGCCATCTCATTCCTAAGTTACTTAAAGTTCTCTCGTGGCTTACA...

CDS

Download CDS FASTA

2595 bp · LXL04_026902|LXL04_026902|OH1004|CDS

ATGAACTACGAACAGAGGTTAATCGCCGCCGCGAAGTGCGTATTTGAAGGAGACACCCGCATCGCCGCCGAGGCTCAAGTCAACTGTTCCGACTTCGGTGTAACGGCGACGCTTAAACCTCACCAAATCGAAGGACTGTCATGGCTTATACGCCGATACCTTATCGGTGTCAACGTTATTCTAGGAGATGAGATGGGACTTGGAAAGACATTACAAGCCATCTCATTCCTAAGTTACTTAAAGTTCTCTCGTGGCTTACA...

Protein

Download Protein FASTA

864 aa · LXL04_026902|LXL04_026902|OH1004|PROTEIN

MNYEQRLIAAAKCVFEGDTRIAAEAQVNCSDFGVTATLKPHQIEGLSWLIRRYLIGVNVILGDEMGLGKTLQAISFLSYLKFSRGLHGPFLILCPLSVTDGWVSEVNQFAPKLTVLRYVGDKQHRRTLRKEMFEHVQKQSSPPHVHSLPFDVLLTTYDIALIDQDFLSQIPWSYAVIDEAQRLKNPSSVFYNVLRESYMMPRCLLMTGTPIQNSLNELWALLHFCMPSVFGTLDQFCSKFKESKGAPIDKDKFKSLRYIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026902`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026902

Location Chr06:5004767-5009496 (+)

Description Similar to CHR10: Probable helicase CHR10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44980`	Probable helicase-like transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026902 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0035861 site of double-strand break Cellular Component

GO:0090734 site of DNA damage Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003678 DNA helicase activity Molecular Function

KEGG gene cross-reference

ath:AT2G44980

bta:524787

hsa:9557

mmu:68058

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.637

Rank 1 · LXL04_026902 · OH-1004

Cytoplasm0.362

Rank 2 · LXL04_026902 · OH-1004

Mitochondrion0.058

Rank 3 · LXL04_026902 · OH-1004

Cell membrane0.039

Rank 4 · LXL04_026902 · OH-1004

Endoplasmic reticulum0.031

Rank 5 · LXL04_026902 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00176.30SNF2-rel_dom41-340 aa

PF11496.15HDA2-3288-545 aa

PF00271.38Helicase_C361-487 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026902	`PF00176.30`	SNF2-rel_dom	41	340	2.4e-68	231.1
LXL04_026902	`PF11496.15`	HDA2-3	288	545	4.1e-08	33.5
LXL04_026902	`PF00271.38`	Helicase_C	361	487	2.6e-19	70.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IV45`	Arabidopsis thaliana	Probable helicase CHR10	65.193%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card