Gene Card
Gene overview
cDNA / CDS / Protein Sequences
759 bp · LXL04_026900|LXL04_026900|OH1004|cDNA
ATGAGAATTAGAATAATAGGGCTCAAATTTTATACACAATCTTTTTTCATCAGGATGGAAAACACAGAAGCAACTTTCTCTACATTTGGTATTTCAGAAGAGGAAGGTGACAAGCTTGTAGCAGAAGTAATCCGCTATATCCTTTTCAAATCACATCATAATTCTGGATGTCCAATCAAAAGAGATGAACTCACTCAACTAATCACAAAAAACTACCCCCAAAGATCACTTCCAAGTATTGTCCTCCAAAAGGCCACCAC...
759 bp · LXL04_026900|LXL04_026900|OH1004|CDS
ATGAGAATTAGAATAATAGGGCTCAAATTTTATACACAATCTTTTTTCATCAGGATGGAAAACACAGAAGCAACTTTCTCTACATTTGGTATTTCAGAAGAGGAAGGTGACAAGCTTGTAGCAGAAGTAATCCGCTATATCCTTTTCAAATCACATCATAATTCTGGATGTCCAATCAAAAGAGATGAACTCACTCAACTAATCACAAAAAACTACCCCCAAAGATCACTTCCAAGTATTGTCCTCCAAAAGGCCACCAC...
Protein
Download Protein FASTA252 aa · LXL04_026900|LXL04_026900|OH1004|PROTEIN
MRIRIIGLKFYTQSFFIRMENTEATFSTFGISEEEGDKLVAEVIRYILFKSHHNSGCPIKRDELTQLITKNYPQRSLPSIVLQKATTKLSTIFGYNLKELQRARPSSNNQTRNSQSSADTKSYIVTSQLDPGVYRKLVEDTKNSHLTGFAFVVIGIVHLAGGKITEESLWHHLGRLGMTQSDERHTDFGSTKQTIETLVQQRYLQKDKTNGPEGLTLIYELAERGLDAALSSTFKDSLSQIVTSEATAIGLD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_026900 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_026900 |
|---|---|
| Location | Chr06:4988962-4990763 (-) |
| Description | Similar to Nsmce3: Non-structural maintenance of chromosomes element 3 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0016925 protein sumoylation Biological Process GO:0031398 positive regulation of protein ubiquitination Biological Process GO:0032204 regulation of telomere maintenance Biological Process GO:0034644 cellular response to UV Biological Process GO:0045746 negative regulation of Notch signaling pathway Biological Process GO:0045787 positive regulation of cell cycle Biological Process |
| KEGG gene cross-reference | hsa:4100 hsa:4103 hsa:4107 hsa:56160 mmu:66647 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01454.26MAGE43-226 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_026900 | PF01454.26 | MAGE | 43 | 226 | 2.4e-40 | 139.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.