LXL04_026898 | RubberDandelionOmics

Gene overview

LXL04_026898

Reference: OH-1004 Chr: Chr06 Coordinates: 4983242-4984453 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_026898|LXL04_026898|OH1004|cDNA

ATGTTGAATTATGAATGGGAAAATCCAAATCCAAACCCATCATCGTCGATCATGTTTAACGGCAATGGCGGAGCAGGCGGTGGACTTGAAGAACTCATCTCGCAATCAATCCAACCAAATCGGATCTctgatcatcatcatcatcagcagcAGCAGCATTCACATAGCTTCAACGATGCCACCATTGTTACTCCTCCGATTATCAATCCCCATGATTTCTTCCTCCAACAGTACCACTACCGCATGCTAAACAACCCTAA...

CDS

Download CDS FASTA

786 bp · LXL04_026898|LXL04_026898|OH1004|CDS

ATGTTGAATTATGAATGGGAAAATCCAAATCCAAACCCATCATCGTCGATCATGTTTAACGGCAATGGCGGAGCAGGCGGTGGACTTGAAGAACTCATCTCGCAATCAATCCAACCAAATCGGATCTCTGATCATCATCATCATCAGCAGCAGCAGCATTCACATAGCTTCAACGATGCCACCATTGTTACTCCTCCGATTATCAATCCCCATGATTTCTTCCTCCAACAGTACCACTACCGCATGCTAAACAACCCTAA...

Protein

Download Protein FASTA

261 aa · LXL04_026898|LXL04_026898|OH1004|PROTEIN

MLNYEWENPNPNPSSSIMFNGNGGAGGGLEELISQSIQPNRISDHHHHQQQQHSHSFNDATIVTPPIINPHDFFLQQYHYRMLNNPNFHDCVIYPPSPSSSSSPVQLSLEIDQSGTFVLMPKLEVVVPYGCNIDFSNSLNLYFSPEEDDYTVNNHRGRRSRSMEVGVMMHSPKCQIEGCNADLSHARHYHRRHKVCEFHSKAATVVTGGLAQRYCQQCSRFHILSEFDEGKRSCRKRLADHNRRRRKLSHNEASNPVNDQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026898`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026898

Location Chr06:4983242-4984453 (-)

Description Similar to SPL8: Squamosa promoter-binding-like protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02065`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	SPL8, an SBP-box gene that affects pollen sac development in Arabidopsis.2003 · DOI: 10.1105/tpc.010678 Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains.2005 · DOI: 10.1016/j.jmb.2005.07.013 SPL8, a local regulator in a subset of gibberellin-mediated developmental processes in Arabidopsis.2007 · DOI: 10.1007/s11103-006-9099-6
`At1g20980`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity).	Arabidopsis AtSPL14, a plant-specific SBP-domain transcription factor, participates in plant development and sensitivity to fumonisin B1.2005 · DOI: 10.1111/j.1365-313x.2005.02334.x

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q01KM7`	Probable transcription factor that plays an important role in building the laminar joint between leaf blade and leaf sheath boundary, thereby controlling ligule and auricle development.	No verified direct reference in this release
`Os04g0656500`	Probable transcription factor that plays an important role in building the laminar joint between leaf blade and leaf sheath boundary, thereby controlling ligule and auricle development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026898 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009554 megasporogenesis Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048653 anther development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G02065

ath:AT1G20980

dosa:Os04g0656500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · LXL04_026898 · OH-1004

Cytoplasm0.111

Rank 2 · LXL04_026898 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_026898 · OH-1004

Endoplasmic reticulum0.023

Rank 4 · LXL04_026898 · OH-1004

Plastid0.015

Rank 5 · LXL04_026898 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03110.20SBP174-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026898	`PF03110.20`	SBP	174	247	1.5e-31	109.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXL3`	Arabidopsis thaliana	Squamosa promoter-binding-like protein 8	42.282%	Swiss-Prot	moderate database homology
`Q8RY95`	Arabidopsis thaliana	Squamosa promoter-binding-like protein 14	69.136%	Swiss-Prot	weak database homology
`Q01KM7`	Oryza sativa subsp. indica	Squamosa promoter-binding-like protein 8	77.215%	Swiss-Prot	weak database homology
`Q7XPY1`	Oryza sativa subsp. japonica	Squamosa promoter-binding-like protein 8	77.215%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card