LXL04_026882 | RubberDandelionOmics

Gene overview

LXL04_026882

Reference: OH-1004 Chr: Chr06 Coordinates: 4610007-4611026 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · LXL04_026882|LXL04_026882|OH1004|cDNA

ATGAAATCGGAGGGCAGTGCCAGTGGCGGTGAAACTTCTGAAGCGGCGTCGAAGATTGGGATGGTGGCGGCAGTCACGGTAGTAGGAAAGCCGAATAATTATCAGCAACAGTTGATGGTGAATGATTGTGGGAAGAAACATGTTTATATTGGTATGCTGTATATGGATCTTTTTGACACTAAAGTTGAAGCTGTCAGGGCTTATGATAAAGCTACAAACAAATGCAATGGAAACGATGTTGTTACAGATTTTGATTCCGG...

CDS

Download CDS FASTA

390 bp · LXL04_026882|LXL04_026882|OH1004|CDS

ATGAAATCGGAGGGCAGTGCCAGTGGCGGTGAAACTTCTGAAGCGGCGTCGAAGATTGGGATGGTGGCGGCAGTCACGGTAGTAGGAAAGCCGAATAATTATCAGCAACAGTTGATGGTGAATGATTGTGGGAAGAAACATGTTTATATTGGTATGCTGTATATGGATCTTTTTGACACTAAAGTTGAAGCTGTCAGGGCTTATGATAAAGCTACAAACAAATGCAATGGAAACGATGTTGTTACAGATTTTGATTCCGG...

Protein

Download Protein FASTA

129 aa · LXL04_026882|LXL04_026882|OH1004|PROTEIN

MKSEGSASGGETSEAASKIGMVAAVTVVGKPNNYQQQLMVNDCGKKHVYIGMLYMDLFDTKVEAVRAYDKATNKCNGNDVVTDFDSGHIYPQCIYVHSVHSAYMCTVCTVHIYAFVNMCICTYVFAKRH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026882`
TK1151 ID	TkA07G015180
OH-1004 ID	LXL04_026882
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026882

Location Chr06:4610007-4611026 (-)

Description Similar to AP2: Floral homeotic protein APETALA 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36920`	Probable transcriptional activator that promotes early floral meristem identity.	No verified direct reference in this release
`At5g67180`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0649100`	Transcription factor.	Genetic control of seed shattering in rice by the APETALA2 transcription factor shattering abortion1.2012 · DOI: 10.1105/tpc.111.094383
`UniProt: B8AVJ9`	Transcription factor.	No verified direct reference in this release
`Os05g0121600`	Probable transcription factor (By similarity).	Coexpression analysis identifies Rice Starch Regulator1, a rice AP2/EREBP family transcription factor, as a novel rice starch biosynthesis regulator.2010 · DOI: 10.1104/pp.110.159517

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026882 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010581 regulation of starch biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048316 seed development Biological Process

KEGG gene cross-reference

ath:AT4G36920

ath:AT5G67180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.463

Rank 1 · LXL04_026882 · OH-1004

Cytoplasm0.410

Rank 2 · LXL04_026882 · OH-1004

Extracellular0.087

Rank 3 · LXL04_026882 · OH-1004

Mitochondrion0.081

Rank 4 · LXL04_026882 · OH-1004

Cell membrane0.061

Rank 5 · LXL04_026882 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P47927`	Arabidopsis thaliana	Floral homeotic protein APETALA 2	66.667%	Swiss-Prot	weak database homology
`Q9FH95`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor TOE3	63.415%	Swiss-Prot	weak database homology
`A0A0N7KJT8`	Oryza sativa subsp. japonica	APETALA2-like protein 5	61.905%	Swiss-Prot	weak database homology
`B8AVJ9`	Oryza sativa subsp. indica	APETALA2-like protein 5	61.905%	Swiss-Prot	weak database homology
`Q2TQ34`	Oryza sativa subsp. japonica	APETALA2-like protein 1	57.143%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card