LXL04_026848 | RubberDandelionOmics

Gene overview

LXL04_026848

Reference: OH-1004 Chr: Chr06 Coordinates: 3714006-3714539 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · LXL04_026848|LXL04_026848|OH1004|cDNA

ATGTATCTCGAGTTACAGTGTCGATCATCAATATATCGCGAACTATGTGTCCAAACTCTTTTGCCATACGTAACAAAAACCGGACTACTAAGCCCTCAACTACTAGCTCAAGTTTCTCTAGCCTCATGTCTATCAAAAGCGCGATTCACCAAGACTTATCTAACCATGGTAGTGAAGAAATTGAACGAAACGAAAGATTCTAGAAACTACCTAGCTATAGAAGATTGTGTTCATCAAATCAACGATGGAGTGAACCAAAT...

CDS

Download CDS FASTA

534 bp · LXL04_026848|LXL04_026848|OH1004|CDS

ATGTATCTCGAGTTACAGTGTCGATCATCAATATATCGCGAACTATGTGTCCAAACTCTTTTGCCATACGTAACAAAAACCGGACTACTAAGCCCTCAACTACTAGCTCAAGTTTCTCTAGCCTCATGTCTATCAAAAGCGCGATTCACCAAGACTTATCTAACCATGGTAGTGAAGAAATTGAACGAAACGAAAGATTCTAGAAACTACCTAGCTATAGAAGATTGTGTTCATCAAATCAACGATGGAGTGAACCAAAT...

Protein

Download Protein FASTA

177 aa · LXL04_026848|LXL04_026848|OH1004|PROTEIN

MYLELQCRSSIYRELCVQTLLPYVTKTGLLSPQLLAQVSLASCLSKARFTKTYLTMVVKKLNETKDSRNYLAIEDCVHQINDGVNQITQSYKELQQMGKDGDEKFMWHESNVLSWVSAALTDATTCIDEILGDDISRREQAMIKARLLNVKQLASNSLVLFNRFTIRYRASRGIKNP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026848`
TK1151 ID	TkA07G010330
OH-1004 ID	LXL04_026848
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026848

Location Chr06:3714006-3714539 (+)

Description Similar to PMEI9: Pectinesterase inhibitor 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62770`	Pectin methylesterase (PME) inhibitor that probably targets root-expressed PME and PME3 in a moderate pH-dependent manner, mainly in slightly acidic conditions (pH 6.3 and 5.0) and to some extent at pH 7.5.	Combined Experimental and Computational Approaches Reveal Distinct pH Dependence of Pectin Methylesterase Inhibitors.2017 · DOI: 10.1104/pp.16.01790
`At3g47380`	Pectin methylesterase (PME) inhibitor involved in the maintenance of cell wall integrity in response to necrotrophic pathogens.	No verified direct reference in this release
`At4g25260`	Pectin methylesterase (PME) inhibitor that can target PME3 in a pH-dependent manner, mainly in slightly acidic conditions (pH 6.0 and 5.0) but not at pH 7.0.	Tuning of Pectin Methylesterification: PECTIN METHYLESTERASE INHIBITOR 7 MODULATES THE PROCESSIVE ACTIVITY OF CO-EXPRESSED PECTIN METHYLESTERASE 3 IN A pH-DEPENDENT MANNER.2015 · DOI: 10.1074/jbc.m115.639534 Structural and dynamical characterization of the pH-dependence of the pectin methylesterase-pectin methylesterase inhibitor complex.2017 · DOI: 10.1074/jbc.ra117.000197
`At1g62760`	Pectin methylesterase (PME) inhibitor involved in the maintenance of cell wall integrity in response to necrotrophic pathogens.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026848 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009641 shade avoidance Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

GO:0046910 pectinesterase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G62760

ath:AT1G62770

ath:AT3G47380

ath:AT4G25260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.491

Rank 1 · LXL04_026848 · OH-1004

Endoplasmic reticulum0.154

Rank 2 · LXL04_026848 · OH-1004

Cytoplasm0.136

Rank 3 · LXL04_026848 · OH-1004

Lysosome / Vacuole0.117

Rank 4 · LXL04_026848 · OH-1004

Cell membrane0.066

Rank 5 · LXL04_026848 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043.21PMEI6-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026848	`PF04043.21`	PMEI	6	160	6.5e-25	88.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SI72`	Arabidopsis thaliana	Pectinesterase inhibitor 9	37.209%	Swiss-Prot	moderate database homology
`Q9STY5`	Arabidopsis thaliana	Pectinesterase inhibitor 11	32.143%	Swiss-Prot	moderate database homology
`Q9SB37`	Arabidopsis thaliana	Pectinesterase inhibitor 7	30.952%	Swiss-Prot	moderate database homology
`Q9SI74`	Arabidopsis thaliana	Pectinesterase inhibitor 10	29.448%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card