LXL04_026820 | RubberDandelionOmics

Gene overview

LXL04_026820

Reference: OH-1004 Chr: Chr06 Coordinates: 3393897-3403127 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5286 bp · LXL04_026820|LXL04_026820|OH1004|cDNA

ATGGCTTCTCCGGAAGTCGAATCCCGCCTTATCAACAGCGTTCTAGTTCCAGCCCTAGAGAAGATAATCAAGAACAGCTCGTGGCGCAAACACTCTAAACTAGGTAACGAATGCAAATCTGTACTTGAACGCATTACATCTCCTGAAAAACCTCCCCCGCTATCACCTACTTCACCTTCATCTGAGGAGAATCAAGCAGGCGTTGAGTCGATATCACATTCAGAAGTTTCCGGCGTCCTGCACGGTTCTGGCGCCTACGA...

CDS

Download CDS FASTA

5286 bp · LXL04_026820|LXL04_026820|OH1004|CDS

ATGGCTTCTCCGGAAGTCGAATCCCGCCTTATCAACAGCGTTCTAGTTCCAGCCCTAGAGAAGATAATCAAGAACAGCTCGTGGCGCAAACACTCTAAACTAGGTAACGAATGCAAATCTGTACTTGAACGCATTACATCTCCTGAAAAACCTCCCCCGCTATCACCTACTTCACCTTCATCTGAGGAGAATCAAGCAGGCGTTGAGTCGATATCACATTCAGAAGTTTCCGGCGTCCTGCACGGTTCTGGCGCCTACGA...

Protein

Download Protein FASTA

1761 aa · LXL04_026820|LXL04_026820|OH1004|PROTEIN

MASPEVESRLINSVLVPALEKIIKNSSWRKHSKLGNECKSVLERITSPEKPPPLSPTSPSSEENQAGVESISHSEVSGVLHGSGAYELSLAESELILSPIIKACSSGDPKIAEPALDCIQKLIAHGYLRGESDPTGGSDAKLLSRLIESVCKCCDLGDEGVELLVLKTILSAVTSIQLRIHGDSLLQIVRTSYDIYLSSKNVVNQTTAKASLIQMLVIVFRRMEADSSTVPLQPIVVAELMEAPEKGGDDDAPMAMFVQG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026820`
TK1151 ID	TkA07G009760
OH-1004 ID	LXL04_026820
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 60.761 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026820

Location Chr06:3393897-3403127 (-)

Description Similar to BIG2: Brefeldin A-inhibited guanine nucleotide-exchange protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60860`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At1g01960`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At4g38200`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At4g35380`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026820 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001881 receptor recycling Biological Process

GO:0006887 exocytosis Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0007032 endosome organization Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0010256 endomembrane system organization Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0032012 regulation of ARF protein signal transduction Biological Process

GO:0032760 positive regulation of tumor necrosis factor production Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043001 Golgi to plasma membrane protein transport Biological Process

KEGG gene cross-reference

ath:AT1G01960

ath:AT3G60860

ath:AT4G35380

ath:AT4G38200

hsa:10564

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.425

Rank 1 · LXL04_026820 · OH-1004

Cytoplasm0.416

Rank 2 · LXL04_026820 · OH-1004

Cell membrane0.163

Rank 3 · LXL04_026820 · OH-1004

Lysosome / Vacuole0.148

Rank 4 · LXL04_026820 · OH-1004

Nucleus0.136

Rank 5 · LXL04_026820 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16213.12DCB13-226 aa

PF12783.14Sec7-like_HUS354-512 aa

PF01369.26Sec7628-809 aa

PF09324.16Sec7-like_HDS1178-1260 aa

PF16206.10Mon2_C1281-1419 aa

PF23325.2TPR_281355-1463 aa

PF20252.4BIG2_C1553-1749 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026820	`PF16213.12`	DCB	13	226	7.8e-37	127.4
LXL04_026820	`PF12783.14`	Sec7-like_HUS	354	512	2.4e-48	164.7
LXL04_026820	`PF01369.26`	Sec7	628	809	6.5e-78	261.3
LXL04_026820	`PF09324.16`	Sec7-like_HDS	1178	1260	4.5e-33	113.7
LXL04_026820	`PF16206.10`	Mon2_C	1281	1419	3e-11	43.0
LXL04_026820	`PF23325.2`	TPR_28	1355	1463	2.5e-09	38.0
LXL04_026820	`PF20252.4`	BIG2_C	1553	1749	1.4e-37	130.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZX8`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 2	69.575%	Swiss-Prot	strong database homology
`Q9LPC5`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 3	69.399%	Swiss-Prot	strong database homology
`F4JSZ5`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 1	47.300%	Swiss-Prot	moderate database homology
`F4JN05`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 4	46.266%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card