LXL04_026795 | RubberDandelionOmics

Gene overview

LXL04_026795

Reference: OH-1004 Chr: Chr06 Coordinates: 3042373-3045448 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · LXL04_026795|LXL04_026795|OH1004|cDNA

ATGGATTGTGTTTATGAAACAATGGCTTCTGAATCTCAACCATACAACTATGATCCTAACAAGTTCCTCAATATCACACAAAACCCGGATGGCACCGTGACCCGACACGCCTCATTTCCATCCTCACCGGCCGAACCTGAACTCAGCACCGACTCGGGACAACTCACCCTCTCAAAAGACATCCCACTCAaccccaccaccaccaccttcctCCGCCTCTACCGCCATGTCTCTCCGCCCACCCGAAAACTCCCTATCAT...

CDS

Download CDS FASTA

348 bp · LXL04_026795|LXL04_026795|OH1004|CDS

ATGGATTGTGTTTATGAAACAATGGCTTCTGAATCTCAACCATACAACTATGATCCTAACAAGTTCCTCAATATCACACAAAACCCGGATGGCACCGTGACCCGACACGCCTCATTTCCATCCTCACCGGCCGAACCTGAACTCAGCACCGACTCGGGACAACTCACCCTCTCAAAAGACATCCCACTCAACCCCACCACCACCACCTTCCTCCGCCTCTACCGCCATGTCTCTCCGCCCACCCGAAAACTCCCTATCAT...

Protein

Download Protein FASTA

115 aa · LXL04_026795|LXL04_026795|OH1004|PROTEIN

MDCVYETMASESQPYNYDPNKFLNITQNPDGTVTRHASFPSSPAEPELSTDSGQLTLSKDIPLNPTTTTFLRLYRHVSPPTRKLPIIVYFHPGGFVFVSATSTPTHVVTPQFPAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026795`
TK1151 ID	TkA03G288090
OH-1004 ID	LXL04_026795
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 93.913 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026795

Location Chr06:3042373-3045448 (-)

Description Similar to CXE8: Probable carboxylesterase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45600`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At5g62180`	Carboxylesterase that possesses esterase activity in vitro with the synthetic substrate p-nitrophenyl acetate (pNPA).	Arabidopsis Carboxylesterase 20 Binds Strigolactone and Increases Branches and Tillers When Ectopically Expressed in Arabidopsis and Maize.2021 · DOI: 10.3389/fpls.2021.639401 Structural insights into strigolactone catabolism by carboxylesterases reveal a conserved conformational regulation.2024 · DOI: 10.1038/s41467-024-50928-3
`At2g45610`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026795 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009820 alkaloid metabolic process Biological Process

GO:1901600 strigolactone metabolic process Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0043722 4-hydroxyphenylacetate decarboxylase activity Molecular Function

GO:0106435 carboxylesterase activity Molecular Function

KEGG gene cross-reference

ag:AFB74618

ath:AT2G45600

ath:AT2G45610

ath:AT5G62180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · LXL04_026795 · OH-1004

Nucleus0.292

Rank 2 · LXL04_026795 · OH-1004

Peroxisome0.080

Rank 3 · LXL04_026795 · OH-1004

Plastid0.074

Rank 4 · LXL04_026795 · OH-1004

Mitochondrion0.069

Rank 5 · LXL04_026795 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64640`	Arabidopsis thaliana	Probable carboxylesterase 8	49.485%	Swiss-Prot	moderate database homology
`Q9LVB8`	Arabidopsis thaliana	Carboxylesterase 20	40.625%	Swiss-Prot	moderate database homology
`O64641`	Arabidopsis thaliana	Probable carboxylesterase 9	34.259%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card