LXL04_026778 | RubberDandelionOmics

Gene overview

LXL04_026778

Reference: OH-1004 Chr: Chr06 Coordinates: 2777210-2780216 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_026778|LXL04_026778|OH1004|cDNA

ATGGAGGGTTATAAGAGATGGGTTCGGAGGAACAAGGAGTATGTTCATTCGTTAGAGTCTCTTGCCAACGGATTAACATGGCTTCTCCCGGAGAGATTCTCAGAGTCGGAAATCGTACCAGAAGCAGTAACATCGATATTGGGGATAGTGACAGCTGTCAATGAACATATAATCGAAACGACTCCAACAACTCCATCTCAAATGGCTCCAAGACCTTTGGAGCCGTCTTCTTTCCCATATACTTTATTCTTGACTTTGAT...

CDS

Download CDS FASTA

1083 bp · LXL04_026778|LXL04_026778|OH1004|CDS

ATGGAGGGTTATAAGAGATGGGTTCGGAGGAACAAGGAGTATGTTCATTCGTTAGAGTCTCTTGCCAACGGATTAACATGGCTTCTCCCGGAGAGATTCTCAGAGTCGGAAATCGTACCAGAAGCAGTAACATCGATATTGGGGATAGTGACAGCTGTCAATGAACATATAATCGAAACGACTCCAACAACTCCATCTCAAATGGCTCCAAGACCTTTGGAGCCGTCTTCTTTCCCATATACTTTATTCTTGACTTTGAT...

Protein

Download Protein FASTA

360 aa · LXL04_026778|LXL04_026778|OH1004|PROTEIN

MEGYKRWVRRNKEYVHSLESLANGLTWLLPERFSESEIVPEAVTSILGIVTAVNEHIIETTPTTPSQMAPRPLEPSSFPYTLFLTLMKDVETLVEVVAQHFLGDDNKWNFIAVTEATKVLARLALLRNSGYKMILQGGETVNDGNPTNDSNHQEDVRGGRLLNQGQNGHFTPQGRALSAMSRFGENARMVSDPTWFRRVEHHQRAIMELPETEIKRPTLSSFLSEKGIPGSLFLIGEVMFITRPLIYVLLIRKYGVKSWL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026778`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026778

Location Chr06:2777210-2780216 (+)

Description Similar to PEX16: Peroxisome biogenesis protein 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45690`	Involved in the formation of peroxisomes, lipid bodies and protein bodies.	The Pex16p homolog SSE1 and storage organelle formation in Arabidopsis seeds.1999 · DOI: 10.1126/science.284.5412.328 The peroxisome deficient Arabidopsis mutant sse1 exhibits impaired fatty acid synthesis.2004 · DOI: 10.1104/pp.103.036772 Genetic and transgenic perturbations of carbon reserve production in Arabidopsis seeds reveal metabolic interactions of biochemical pathways.2006 · DOI: 10.1007/s00425-006-0337-6 Arabidopsis peroxin 16 trafficks through the ER and an intermediate compartment to pre-existing peroxisomes via overlapping molecular targeting signals.2007 · DOI: 10.1093/jxb/erm018 Functional classification of Arabidopsis peroxisome biogenesis factors proposed from analyses of knockdown mutants.2007 · DOI: 10.1093/pcp/pcm053

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026778 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006625 protein targeting to peroxisome Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0007031 peroxisome organization Biological Process

GO:0016557 peroxisome membrane biogenesis Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0022615 protein to membrane docking Biological Process

GO:0032581 ER-dependent peroxisome organization Biological Process

GO:0045046 protein import into peroxisome membrane Biological Process

GO:0106101 ER-dependent peroxisome localization Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G45690

bta:510447

mmu:18633

xla:432288

xtr:100145130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.792

Rank 1 · LXL04_026778 · OH-1004

Mitochondrion0.185

Rank 2 · LXL04_026778 · OH-1004

Cytoplasm0.055

Rank 3 · LXL04_026778 · OH-1004

Nucleus0.051

Rank 4 · LXL04_026778 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_026778 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08610.16Pex163-351 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026778	`PF08610.16`	Pex16	3	351	5.3e-88	296.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8S1`	Arabidopsis thaliana	Peroxisome biogenesis protein 16	54.839%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card