LXL04_026765 | RubberDandelionOmics

Gene overview

LXL04_026765

Reference: OH-1004 Chr: Chr06 Coordinates: 2658326-2661226 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1089 bp · LXL04_026765|LXL04_026765|OH1004|cDNA

ATGGTGGCACATGTGAGTGTCATCTCCTTCTCCTCTTCTTGTCATCTCCTTCATTCTTCACCCCAGTTatctctctctttgcataaaaCCATCGCAATGGCGACAATGAATACGGATCCAGTACGAGAATGGATTCTAACAGAAGGAAAAGCGACTCAAATAACCGGGATTAGTCCGGTCGGCGGTGGTTGCATCAATCTTGCAAGCCGATACAACACCGATGCCGGTTCTTTTTTCGTTAAGACAAATAGGAGTATTGG...

CDS

Download CDS FASTA

1089 bp · LXL04_026765|LXL04_026765|OH1004|CDS

ATGGTGGCACATGTGAGTGTCATCTCCTTCTCCTCTTCTTGTCATCTCCTTCATTCTTCACCCCAGTTATCTCTCTCTTTGCATAAAACCATCGCAATGGCGACAATGAATACGGATCCAGTACGAGAATGGATTCTAACAGAAGGAAAAGCGACTCAAATAACCGGGATTAGTCCGGTCGGCGGTGGTTGCATCAATCTTGCAAGCCGATACAACACCGATGCCGGTTCTTTTTTCGTTAAGACAAATAGGAGTATTGG...

Protein

Download Protein FASTA

362 aa · LXL04_026765|LXL04_026765|OH1004|PROTEIN

MVAHVSVISFSSSCHLLHSSPQLSLSLHKTIAMATMNTDPVREWILTEGKATQITGISPVGGGCINLASRYNTDAGSFFVKTNRSIGPEMFEGEALGLNAMYETNSIRVPRPYKVGELPTGGSYIIMEFIEFGSSRGDQAVLGRKLAEMHKAAKSEKGFGFHVNNTIGRHVYLFLVFQIYNWVDYLEYNVLIKRIIGILACSTPQINTWTSDWVDFYAEHRLTFQLKLAQQQFGDSAIYEKGQRLVKNLGALFEDVTIEP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026765`
TK1151 ID	TkA07G006480
OH-1004 ID	LXL04_026765
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.300
Protein coverage (%)	TK1151 98.442 / OH-1004 96.409 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026765

Location Chr06:2658326-2661226 (+)

Description Similar to At3g61080: Protein-ribulosamine 3-kinase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61080`	Initiates a process leading to the deglycation of proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XBT1`	Initiates a process leading to the deglycation of proteins.	No verified direct reference in this release
`Os03g0117800`	Initiates a process leading to the deglycation of proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026765 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0036528 peptidyl-lysine deglycation Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0102193 protein-ribulosamine 3-kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G61080

dosa:Os03g0117800

hsa:79672

mmu:238024

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.418

Rank 1 · LXL04_026765 · OH-1004

Mitochondrion0.210

Rank 2 · LXL04_026765 · OH-1004

Nucleus0.184

Rank 3 · LXL04_026765 · OH-1004

Peroxisome0.169

Rank 4 · LXL04_026765 · OH-1004

Plastid0.155

Rank 5 · LXL04_026765 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03881.21Fructosamin_kin41-170 aa

PF01636.30APH57-313 aa

PF03881.21Fructosamin_kin201-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026765	`PF03881.21`	Fructosamin_kin	41	170	9.1e-96	321.2
LXL04_026765	`PF01636.30`	APH	57	313	4.1e-07	30.7
LXL04_026765	`PF03881.21`	Fructosamin_kin	201	358	9.1e-96	321.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LEW8`	Arabidopsis thaliana	Protein-ribulosamine 3-kinase, chloroplastic	69.890%	Swiss-Prot	strong database homology
`A2XBT1`	Oryza sativa subsp. indica	Protein-ribulosamine 3-kinase, chloroplastic	72.644%	Swiss-Prot	strong database homology
`Q10SM2`	Oryza sativa subsp. japonica	Protein-ribulosamine 3-kinase, chloroplastic	72.644%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card