LXL04_026733 | RubberDandelionOmics

Gene overview

LXL04_026733

Reference: OH-1004 Chr: Chr06 Coordinates: 2148961-2153869 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1467 bp · LXL04_026733|LXL04_026733|OH1004|cDNA

ATGAATAGTAACTACGCACGAGGAGGAGGGGGAAGATATCCGCCGGGAATTGGGCGCGGTGGTGGGAATAATTATGGAAACCCTAATCCTAATTTCCAACAACAGTATGCTCAAAGGAATCCAGCGCACCACCAGCAGTTTCAACAACAGcagcagcagcaacaacaacaatggCTGAGAAGAAACCCTGTCGGAAATGATTCGAGCGCGGTTGACGAAGTGGAAAAGACAATACAGTCGGAGACTGCTGACCCGAGTGG...

CDS

Download CDS FASTA

1467 bp · LXL04_026733|LXL04_026733|OH1004|CDS

ATGAATAGTAACTACGCACGAGGAGGAGGGGGAAGATATCCGCCGGGAATTGGGCGCGGTGGTGGGAATAATTATGGAAACCCTAATCCTAATTTCCAACAACAGTATGCTCAAAGGAATCCAGCGCACCACCAGCAGTTTCAACAACAGCAGCAGCAGCAACAACAACAATGGCTGAGAAGAAACCCTGTCGGAAATGATTCGAGCGCGGTTGACGAAGTGGAAAAGACAATACAGTCGGAGACTGCTGACCCGAGTGG...

Protein

Download Protein FASTA

488 aa · LXL04_026733|LXL04_026733|OH1004|PROTEIN

MNSNYARGGGGRYPPGIGRGGGNNYGNPNPNFQQQYAQRNPAHHQQFQQQQQQQQQQWLRRNPVGNDSSAVDEVEKTIQSETADPSGQDWKAQLRLPPADTRYRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQDSNVIQVVILVPTRELALQTSQVCKELGKHLNIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLSKKGICVLKDCAML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026733`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026733

Location Chr06:2148961-2153869 (+)

Description Similar to RH8: DEAD-box ATP-dependent RNA helicase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00660`	ATP-dependent RNA helicase involved in mRNA turnover, and more specifically in mRNA decapping.	No verified direct reference in this release
`At2g45810`	ATP-dependent RNA helicase involved in mRNA turnover, and more specifically in mRNA decapping.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0641800`	ATP-dependent RNA helicase involved in mRNA turnover, and more specifically in mRNA decapping.	No verified direct reference in this release
`Os04g0533000`	ATP-dependent RNA helicase involved in mRNA turnover, and more specifically in mRNA decapping.	No verified direct reference in this release
`Os10g0503700`	ATP-dependent RNA helicase involved in mRNA turnover, and more specifically in mRNA decapping.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026733 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0016032 viral process Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0019060 intracellular transport of viral protein in host cell Biological Process

GO:0033962 P-body assembly Biological Process

GO:0034063 stress granule assembly Biological Process

GO:0051028 mRNA transport Biological Process

GO:0000932 P-body Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0043657 host cell Cellular Component

KEGG gene cross-reference

ath:AT2G45810

ath:AT4G00660

dosa:Os02g0641800

dosa:Os04g0533000

dosa:Os10g0503700

osa:4336501

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.609

Rank 1 · LXL04_026733 · OH-1004

Nucleus0.497

Rank 2 · LXL04_026733 · OH-1004

Mitochondrion0.045

Rank 3 · LXL04_026733 · OH-1004

Endoplasmic reticulum0.044

Rank 4 · LXL04_026733 · OH-1004

Cell membrane0.038

Rank 5 · LXL04_026733 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD138-303 aa

PF00271.38Helicase_C338-446 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026733	`PF00270.36`	DEAD	138	303	1.1e-46	159.4
LXL04_026733	`PF00271.38`	Helicase_C	338	446	6.4e-32	110.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXK6`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 8	83.300%	Swiss-Prot	strong database homology
`Q94BV4`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 6	75.192%	Swiss-Prot	strong database homology
`Q6H7S2`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 8	81.548%	Swiss-Prot	strong database homology
`Q7XMK8`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 6	80.684%	Swiss-Prot	strong database homology
`Q109G2`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 12	87.963%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card