LXL04_026716 | RubberDandelionOmics

Gene overview

LXL04_026716

Reference: OH-1004 Chr: Chr06 Coordinates: 1890815-1895721 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · LXL04_026716|LXL04_026716|OH1004|cDNA

ATGGCGGCTCTAGCGAAGCTGCTACTCAAGAGAAGAAACTTCTTCGCTTCCGGAGAAAAACTGATCGGAGCTAAATTCTACACATCTCATCCATTGCCGGAATCGTCGTTCGCTCAGAGAATCAGAGATCTGCCGAAAGATCTACCTGGTACTAACATCAAAAGGGACGCCTCTCAGATTATTGGTAAAACACCCCTCGTTTATCTCAACAAAGTCACAGAGGGATGTGGTGCATATATAGCAGTCAAACAAGAGCATTT...

CDS

Download CDS FASTA

1119 bp · LXL04_026716|LXL04_026716|OH1004|CDS

ATGGCGGCTCTAGCGAAGCTGCTACTCAAGAGAAGAAACTTCTTCGCTTCCGGAGAAAAACTGATCGGAGCTAAATTCTACACATCTCATCCATTGCCGGAATCGTCGTTCGCTCAGAGAATCAGAGATCTGCCGAAAGATCTACCTGGTACTAACATCAAAAGGGACGCCTCTCAGATTATTGGTAAAACACCCCTCGTTTATCTCAACAAAGTCACAGAGGGATGTGGTGCATATATAGCAGTCAAACAAGAGCATTT...

Protein

Download Protein FASTA

372 aa · LXL04_026716|LXL04_026716|OH1004|PROTEIN

MAALAKLLLKRRNFFASGEKLIGAKFYTSHPLPESSFAQRIRDLPKDLPGTNIKRDASQIIGKTPLVYLNKVTEGCGAYIAVKQEHFQPSASIKDRPALSMMIDAEEKGLITPGKTVLIEPTSGNMGISMAFMAALKGYKMVLTMPSYTSLERRVTMRAFGADLVLTDPTKGMGGTVKKAYDLLEQTPDAFMLQQFSNPANTKVHFETTGPEIWDDTNGKVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGLEPTESNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026716`
TK1151 ID	TkA07G003680
OH-1004 ID	LXL04_026716
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026716

Location Chr06:1890815-1895721 (-)

Description Similar to PCAS-1: Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61440`	Acts as a major beta-cyanoalanine synthase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026716 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006534 cysteine metabolic process Biological Process

GO:0006535 L-cysteine biosynthetic process from L-serine Biological Process

GO:0006955 immune response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009836 fruit ripening, climacteric Biological Process

GO:0019344 L-cysteine biosynthetic process Biological Process

GO:0019499 cyanide metabolic process Biological Process

GO:0019500 cyanide catabolic process Biological Process

GO:0051410 detoxification of nitrogen compound Biological Process

GO:0080147 root hair cell development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G61440

mdm:103401891

mdm:103405317

sot:102601315

sot:102604154

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.934

Rank 1 · LXL04_026716 · OH-1004

Cytoplasm0.071

Rank 2 · LXL04_026716 · OH-1004

Nucleus0.052

Rank 3 · LXL04_026716 · OH-1004

Cell membrane0.022

Rank 4 · LXL04_026716 · OH-1004

Plastid0.016

Rank 5 · LXL04_026716 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00291.32PALP58-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026716	`PF00291.32`	PALP	58	343	5.1e-72	243.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S757`	Arabidopsis thaliana	Bifunctional L-3-cyanoalanine synthase/cysteine synthase C1, mitochondrial	77.688%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card