LXL04_026708 | RubberDandelionOmics

Gene overview

LXL04_026708

Reference: OH-1004 Chr: Chr06 Coordinates: 1735900-1737197 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · LXL04_026708|LXL04_026708|OH1004|cDNA

ATGTATAAACATGAAATACGTTTCCATATTCAAGAAGAAATCATGAAAAGACTTCCCGTGAAATCATTGCTTCAGTTCAGAACCGTGTCCAAAACATGGAAGTCTTTAATCGACAGCTCTGATTTTATCACTGCTCACATCTTCCACCGCCACACTCAGCAACATCATCTTCTTGCATCATATGCAAATCCGATGGATGAGACACAGTATGTTAGCTTTATCGATGATGATACTTTACCCAAACAGAGGTCTATTCACAC...

CDS

Download CDS FASTA

870 bp · LXL04_026708|LXL04_026708|OH1004|CDS

ATGTATAAACATGAAATACGTTTCCATATTCAAGAAGAAATCATGAAAAGACTTCCCGTGAAATCATTGCTTCAGTTCAGAACCGTGTCCAAAACATGGAAGTCTTTAATCGACAGCTCTGATTTTATCACTGCTCACATCTTCCACCGCCACACTCAGCAACATCATCTTCTTGCATCATATGCAAATCCGATGGATGAGACACAGTATGTTAGCTTTATCGATGATGATACTTTACCCAAACAGAGGTCTATTCACAC...

Protein

Download Protein FASTA

289 aa · LXL04_026708|LXL04_026708|OH1004|PROTEIN

MYKHEIRFHIQEEIMKRLPVKSLLQFRTVSKTWKSLIDSSDFITAHIFHRHTQQHHLLASYANPMDETQYVSFIDDDTLPKQRSIHTLPPFLKQLIHPEVVGSSHGLFCLYDSNAIFTTKMVVLWNPSIRKLVVVDMPNKEFIGFGLWSFEKFEVIQLPDSLARPDLGNLYTSKLRGSLAILKYKDNIISVWMMDHGVEISFTKLFTIETPPFVIGFRNSGVPIMQVTNDDDGQSKLVVYEPKSKHKHVIETSDSHYAFY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026708`
TK1151 ID	TkA07G002900
OH-1004 ID	LXL04_026708
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 50.410 / OH-1004 42.561 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026708

Location Chr06:1735900-1737197 (-)

Description Similar to SON1: Protein SUPPRESSOR OF NIM1 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17310`	Negatively regulates a plant defense signaling pathway which is independent of salicylic acid (SA) and systemic acquired resistance (SAR).	Arabidopsis SON1 is an F-box protein that regulates a novel induced defense response independent of both salicylic acid and systemic acquired resistance.2002 · DOI: 10.1105/tpc.001867
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At2g21930`	F-box protein At2g21930.	No verified direct reference in this release
`At1g32430`	Putative F-box/kelch-repeat protein At1g32430.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026708 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT1G32430

ath:AT1G47790

ath:AT2G17310

ath:AT2G21930

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.666

Rank 1 · LXL04_026708 · OH-1004

Nucleus0.426

Rank 2 · LXL04_026708 · OH-1004

Endoplasmic reticulum0.073

Rank 3 · LXL04_026708 · OH-1004

Cell membrane0.066

Rank 4 · LXL04_026708 · OH-1004

Extracellular0.034

Rank 5 · LXL04_026708 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box9-42 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026708	`PF00646.39`	F-box	9	42	2e-09	37.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LL17`	Arabidopsis thaliana	Protein SUPPRESSOR OF NIM1 1	29.167%	Swiss-Prot	weak database homology
`Q9FZF8`	Arabidopsis thaliana	Putative F-box protein At1g47790	30.435%	Swiss-Prot	weak database homology
`Q9LIR8`	Arabidopsis thaliana	F-box/kelch-repeat protein At3g23880	28.276%	Swiss-Prot	weak database homology
`Q9SJ06`	Arabidopsis thaliana	F-box protein At2g21930	28.889%	Swiss-Prot	weak database homology
`Q9LQL4`	Arabidopsis thaliana	Putative F-box/kelch-repeat protein At1g32430	24.309%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card