LXL04_026696 | RubberDandelionOmics

Gene overview

LXL04_026696

Reference: OH-1004 Chr: Chr06 Coordinates: 1539844-1546803 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2472 bp · LXL04_026696|LXL04_026696|OH1004|cDNA

ATGAAAGAGATTAGAGATGGAACAAAAAGTAACAAAATATCCCAACCGCTTGTTTTAGACATAGAAGACTTCAAGGGCGACTTCTCATTCGATGCTTTATTTGGAAACTTAGTAAATGAGTTACTGCCTTCttttcaagaagaagaagctgatACATTAGAAGCAAATGGTAATATTAATGGGCATGATTCTTTGACTAATGGAAGGTCAGTACAACAAGGGCAATCAAGTCCTTTATTTCCAGAAGTAGATGCATTATT...

CDS

Download CDS FASTA

2472 bp · LXL04_026696|LXL04_026696|OH1004|CDS

ATGAAAGAGATTAGAGATGGAACAAAAAGTAACAAAATATCCCAACCGCTTGTTTTAGACATAGAAGACTTCAAGGGCGACTTCTCATTCGATGCTTTATTTGGAAACTTAGTAAATGAGTTACTGCCTTCTTTTCAAGAAGAAGAAGCTGATACATTAGAAGCAAATGGTAATATTAATGGGCATGATTCTTTGACTAATGGAAGGTCAGTACAACAAGGGCAATCAAGTCCTTTATTTCCAGAAGTAGATGCATTATT...

Protein

Download Protein FASTA

823 aa · LXL04_026696|LXL04_026696|OH1004|PROTEIN

MKEIRDGTKSNKISQPLVLDIEDFKGDFSFDALFGNLVNELLPSFQEEEADTLEANGNINGHDSLTNGRSVQQGQSSPLFPEVDALLSMFKNSCSQLVEIRKQVDGRLFNLKKDVSAQDSKHRKTLGELEKGVDGLFDSFARLDSRISSVGQTAAKIGDHLQSADSQRETASQTMELIKYLMEFNSSPGDLMELSPLFSDDSRVAEAASIAQKLRSFAEEDIGRQGVTMQSVPGNATASRGLEVAVGNLQEYCNELENRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026696`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026696

Location Chr06:1539844-1546803 (-)

Description Similar to SEC10a: Exocyst complex component SEC10a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g12370`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At5g12365`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0238100`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026696 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006887 exocytosis Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0015031 protein transport Biological Process

GO:0060321 acceptance of pollen Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0090148 membrane fission Biological Process

GO:0090522 vesicle tethering involved in exocytosis Biological Process

GO:0000145 exocyst Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G12370

ddi:DDB_G0287881

dosa:Os12g0238100

hsa:10640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.513

Rank 1 · LXL04_026696 · OH-1004

Golgi apparatus0.355

Rank 2 · LXL04_026696 · OH-1004

Lysosome / Vacuole0.197

Rank 3 · LXL04_026696 · OH-1004

Nucleus0.183

Rank 4 · LXL04_026696 · OH-1004

Cell membrane0.148

Rank 5 · LXL04_026696 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20667.4Sec10_N84-200 aa

PF07393.18Sec10_HB206-815 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026696	`PF20667.4`	Sec10_N	84	200	2.2e-31	109.1
LXL04_026696	`PF07393.18`	Sec10_HB	206	815	4.2e-144	482.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`X5JA13`	Arabidopsis thaliana	Exocyst complex component SEC10a	79.708%	Swiss-Prot	strong database homology
`X5JB51`	Arabidopsis thaliana	Exocyst complex component SEC10b	80.316%	Swiss-Prot	strong database homology
`Q2QV94`	Oryza sativa subsp. japonica	Exocyst complex component 5	73.201%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card