LXL04_026650 | RubberDandelionOmics

Gene overview

LXL04_026650

Reference: OH-1004 Chr: Chr06 Coordinates: 889978-891352 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1152 bp · LXL04_026650|LXL04_026650|OH1004|cDNA

ATGGAGGATCTAAACAAAATCTTCTCCCATTTCCTAATCCTAATCCtccttcatcttcttcatcccTCATCAGCATCATCACCCAACTGCCCAATCTCATACTGTGGCTCAACCCCATACTCAGTTCACTTCCCATTCCGTATGCTCAACCAACAACCAGACATCTGTGGCTATCCGGGGTTCGATCTTTATTGCAACAGGCAAAAAACCGTGACATTAAACCTCCCAAATTCAGGAAAGTTTTCAGTACGAAACATCGA...

CDS

Download CDS FASTA

1152 bp · LXL04_026650|LXL04_026650|OH1004|CDS

ATGGAGGATCTAAACAAAATCTTCTCCCATTTCCTAATCCTAATCCTCCTTCATCTTCTTCATCCCTCATCAGCATCATCACCCAACTGCCCAATCTCATACTGTGGCTCAACCCCATACTCAGTTCACTTCCCATTCCGTATGCTCAACCAACAACCAGACATCTGTGGCTATCCGGGGTTCGATCTTTATTGCAACAGGCAAAAAACCGTGACATTAAACCTCCCAAATTCAGGAAAGTTTTCAGTACGAAACATCGA...

Protein

Download Protein FASTA

383 aa · LXL04_026650|LXL04_026650|OH1004|PROTEIN

MEDLNKIFSHFLILILLHLLHPSSASSPNCPISYCGSTPYSVHFPFRMLNQQPDICGYPGFDLYCNRQKTVTLNLPNSGKFSVRNIDYRSQIVQVYDPSGCSASRLLNMDLSGSPFSASPIRNYTLLSCPVEVATSRFPIVTCLSNSTYSTLATSSVSFAMLMANRSACQIIGSLRSPVSRYQFQEGLTSNLNTDIFLTWDAPNCQDCVTDGGTCGYTNSSMEEIACFDETKKGSKRAMMALIIISIALALPAIAISCVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026650`
TK1151 ID	TkAUNG081510
OH-1004 ID	LXL04_026650
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026650

Location Chr06:889978-891352 (+)

Description Similar to ATL21A: Putative RING-H2 finger protein ATL21A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46495`	Putative RING-H2 finger protein ATL21A.	No verified direct reference in this release
`At2g25410`	RING-H2 finger protein ATL22.	No verified direct reference in this release
`At2g46494`	Putative RING-H2 finger protein ATL21B.	No verified direct reference in this release
`At1g28040`	RING-H2 finger protein ATL20.	No verified direct reference in this release
`At2g46493`	Putative RING-H2 finger protein ATL21C.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026650 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28040

ath:AT2G25410

ath:AT2G46493

ath:AT2G46494

ath:AT2G46495

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.779

Rank 1 · LXL04_026650 · OH-1004

Endoplasmic reticulum0.109

Rank 2 · LXL04_026650 · OH-1004

Cytoplasm0.092

Rank 3 · LXL04_026650 · OH-1004

Nucleus0.084

Rank 4 · LXL04_026650 · OH-1004

Lysosome / Vacuole0.043

Rank 5 · LXL04_026650 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947.12GUB_WAK_bind30-97 aa

PF14380.12WAK_assoc182-228 aa

PF12861.14zf-ANAPC11328-374 aa

PF12678.14zf-rbx1329-373 aa

PF13639.13zf-RING_2330-373 aa

PF17123.12zf-RING_11331-359 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026650	`PF13947.12`	GUB_WAK_bind	30	97	1.8e-16	60.9
LXL04_026650	`PF14380.12`	WAK_assoc	182	228	3.2e-06	28.5
LXL04_026650	`PF12861.14`	zf-ANAPC11	328	374	5.4e-06	27.1
LXL04_026650	`PF12678.14`	zf-rbx1	329	373	4.5e-07	30.7
LXL04_026650	`PF13639.13`	zf-RING_2	330	373	5.9e-13	49.6
LXL04_026650	`PF17123.12`	zf-RING_11	331	359	8.7e-07	29.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0CH01`	Arabidopsis thaliana	Putative RING-H2 finger protein ATL21A	45.109%	Swiss-Prot	moderate database homology
`Q9SKK8`	Arabidopsis thaliana	RING-H2 finger protein ATL22	40.456%	Swiss-Prot	moderate database homology
`P0CH02`	Arabidopsis thaliana	Putative RING-H2 finger protein ATL21B	41.160%	Swiss-Prot	moderate database homology
`Q9C7E9`	Arabidopsis thaliana	RING-H2 finger protein ATL20	40.256%	Swiss-Prot	moderate database homology
`P0CH03`	Arabidopsis thaliana	Putative RING-H2 finger protein ATL21C	37.752%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card