LXL04_026625 | RubberDandelionOmics

Gene overview

LXL04_026625

Reference: OH-1004 Chr: Chr06 Coordinates: 223664-226384 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1815 bp · LXL04_026625|LXL04_026625|OH1004|cDNA

ATGGGCCAGTGCTACGGGAAGACAATTCCTACTAGCGACAACGACGGCCCCACCACCATCATCGCCGCCGGAGAGCAACAACGTACTTATCCTCAGTCTCCTTTCCCTTCATCTGCTAACAACGGCGTCATCCACGTCCCCTCCGTAAAAAACACGCCGGCCCGATCCTCGGCAGGGACGAGTCCATGGTCCAGTCCCTACCCTCACGGAATAGCCAGTCCATTACCGGCCGGGGTTTCGCCGTCTCCGGCGCGATCGTC...

CDS

Download CDS FASTA

1815 bp · LXL04_026625|LXL04_026625|OH1004|CDS

ATGGGCCAGTGCTACGGGAAGACAATTCCTACTAGCGACAACGACGGCCCCACCACCATCATCGCCGCCGGAGAGCAACAACGTACTTATCCTCAGTCTCCTTTCCCTTCATCTGCTAACAACGGCGTCATCCACGTCCCCTCCGTAAAAAACACGCCGGCCCGATCCTCGGCAGGGACGAGTCCATGGTCCAGTCCCTACCCTCACGGAATAGCCAGTCCATTACCGGCCGGGGTTTCGCCGTCTCCGGCGCGATCGTC...

Protein

Download Protein FASTA

604 aa · LXL04_026625|LXL04_026625|OH1004|PROTEIN

MGQCYGKTIPTSDNDGPTTIIAAGEQQRTYPQSPFPSSANNGVIHVPSVKNTPARSSAGTSPWSSPYPHGIASPLPAGVSPSPARSSTPGRRFFKRPFPPPSPAKHIKASLARRFGHAKQPREGPIPEDGAAVEPEVQSLDKNFGYNKNFGAKYELGKEIGRGHFGHTCHARGKKGELKDLALAVKIISKVKMTTAISIEDVRREVKILRALSGHKHLIHFYDACEDTNNVYIVMELCEGGELLDRILSRGGRYTETDAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026625`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026625

Location Chr06:223664-226384 (+)

Description Similar to CRK3: CDPK-related kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46700`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	No verified direct reference in this release
`At5g24430`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At3g49370`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At3g50530`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026625 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010150 leaf senescence Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G46700

ath:AT3G49370

ath:AT3G50530

ath:AT5G24430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.517

Rank 1 · LXL04_026625 · OH-1004

Cytoplasm0.322

Rank 2 · LXL04_026625 · OH-1004

Nucleus0.219

Rank 3 · LXL04_026625 · OH-1004

Golgi apparatus0.060

Rank 4 · LXL04_026625 · OH-1004

Endoplasmic reticulum0.056

Rank 5 · LXL04_026625 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase154-416 aa

PF07714.24PK_Tyr_Ser-Thr155-406 aa

PF06293.21Kdo230-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026625	`PF00069.32`	Pkinase	154	416	8.5e-70	235.8
LXL04_026625	`PF07714.24`	PK_Tyr_Ser-Thr	155	406	2.7e-32	112.8
LXL04_026625	`PF06293.21`	Kdo	230	307	9.8e-06	25.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUZ2`	Arabidopsis thaliana	CDPK-related kinase 3	71.053%	Swiss-Prot	strong database homology
`Q9FIM9`	Arabidopsis thaliana	CDPK-related kinase 4	64.590%	Swiss-Prot	strong database homology
`Q9SG12`	Arabidopsis thaliana	CDPK-related kinase 6	64.309%	Swiss-Prot	strong database homology
`Q9SCS2`	Arabidopsis thaliana	CDPK-related kinase 5	64.641%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card