LXL04_026611 | RubberDandelionOmics

Gene overview

LXL04_026611

Reference: OH-1004 Chr: Chr05 Coordinates: 129504329-129508331 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · LXL04_026611|LXL04_026611|OH1004|cDNA

ATGCTAGGGTTCCTACCGACCGTAAACCCTACCAACCATAAAATCGCTGCGCCTTTTATTGAAACTCCAAGTGACTCCAGCTCAATCATGTCGGTTCTTCAGCATAATCACATAGCAGCTTCACTATCATCATCAACGTCCTCCTTCTTTGCTCAAAATGGCTTCGATGCTCTAAGACCTCAGATTGTAAGTGTACCTCAAAAAAAGGCGGGGATTTGCAAATGTGTAGCTACTTCCCCGGCTGAACAGACTGCTTACAA...

CDS

Download CDS FASTA

1527 bp · LXL04_026611|LXL04_026611|OH1004|CDS

ATGCTAGGGTTCCTACCGACCGTAAACCCTACCAACCATAAAATCGCTGCGCCTTTTATTGAAACTCCAAGTGACTCCAGCTCAATCATGTCGGTTCTTCAGCATAATCACATAGCAGCTTCACTATCATCATCAACGTCCTCCTTCTTTGCTCAAAATGGCTTCGATGCTCTAAGACCTCAGATTGTAAGTGTACCTCAAAAAAAGGCGGGGATTTGCAAATGTGTAGCTACTTCCCCGGCTGAACAGACTGCTTACAA...

Protein

Download Protein FASTA

508 aa · LXL04_026611|LXL04_026611|OH1004|PROTEIN

MLGFLPTVNPTNHKIAAPFIETPSDSSSIMSVLQHNHIAASLSSSTSSFFAQNGFDALRPQIVSVPQKKAGICKCVATSPAEQTAYKTKVSRNGNIAKLQAGYLFPEIGRRKAAHMLKYPDAQVISLGIGDTTEPIPDVITKAMAKRALGLSTVEGYSGYGAEQGEKELRARLASTFYANLGIEEDDIFVSDGAKSDISRLQVLFGSNVTMAVQDPSYPVTKFNIMHSLTLNYKNAYVDSSVIMGQTGEYQKDVEKFGKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026611`
TK1151 ID	TkA06G000600
OH-1004 ID	LXL04_026611
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026611

Location Chr05:129504329-129508331 (-)

Description Similar to DAP: LL-diaminopimelate aminotransferase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33680`	Required for lysine biosynthesis.	An LL-diaminopimelate aminotransferase defines a novel variant of the lysine biosynthesis pathway in plants.2006 · DOI: 10.1104/pp.105.072629
`At2g13810`	Aminotransferase involved in local and systemic acquired resistance (SAR) to the bacterial pathogen P.syringae.	Divergent roles in Arabidopsis thaliana development and defense of two homologous genes, aberrant growth and death2 and AGD2-LIKE DEFENSE RESPONSE PROTEIN1, encoding novel aminotransferases.2004 · DOI: 10.1105/tpc.019372 A key role for ALD1 in activation of local and systemic defenses in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02200.x Arabidopsis proteins important for modulating defense responses to Pseudomonas syringae that secrete HopW1-1.2008 · DOI: 10.1111/j.1365-313x.2008.03439.x A lesion-mimic syntaxin double mutant in Arabidopsis reveals novel complexity of pathogen defense signaling.2008 · DOI: 10.1093/mp/ssn011 Suppression of edr2-mediated powdery mildew resistance, cell death and ethylene-induced senescence by mutations in ALD1 in Arabidopsis.2011 · DOI: 10.1016/j.jgg.2011.03.001 Pipecolic acid, an endogenous mediator of defense amplification and priming, is a critical regulator of inducible plant immunity.2012 · DOI: 10.1105/tpc.112.103564 ALD1 Regulates Basal Immune Components and Early Inducible Defense Responses in Arabidopsis.2015 · DOI: 10.1094/mpmi-06-14-0187-r Characterization of a Pipecolic Acid Biosynthesis Pathway Required for Systemic Acquired Resistance.2016 · DOI: 10.1105/tpc.16.00486

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0299900`	Required for lysine biosynthesis.	No verified direct reference in this release
`Os03g0195100`	Probable aminotransferase that may generate amino-acid-derived defense signals and be involved in resistance to pathogens.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026611 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009089 L-lysine biosynthetic process via diaminopimelate Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0010150 leaf senescence Biological Process

GO:0033362 L-lysine biosynthetic process via diaminopimelate, diaminopimelate-aminotransferase pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0062034 L-pipecolic acid biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G13810

ath:AT4G33680

dosa:Os03g0195100

dosa:Os03g0299900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.972

Rank 1 · LXL04_026611 · OH-1004

Mitochondrion0.048

Rank 2 · LXL04_026611 · OH-1004

Cytoplasm0.028

Rank 3 · LXL04_026611 · OH-1004

Peroxisome0.018

Rank 4 · LXL04_026611 · OH-1004

Nucleus0.017

Rank 5 · LXL04_026611 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155.28Aminotran_1_2259-503 aa

PF04864.20Alliinase_C279-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026611	`PF00155.28`	Aminotran_1_2	259	503	6.9e-38	131.5
LXL04_026611	`PF04864.20`	Alliinase_C	279	368	3.9e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZN9`	Arabidopsis thaliana	LL-diaminopimelate aminotransferase, chloroplastic	74.316%	Swiss-Prot	strong database homology
`Q9ZQI7`	Arabidopsis thaliana	Aminotransferase ALD1, chloroplastic	59.762%	Swiss-Prot	strong database homology
`Q10MQ2`	Oryza sativa subsp. japonica	Probable LL-diaminopimelate aminotransferase, chloroplastic	79.310%	Swiss-Prot	strong database homology
`Q6VMN7`	Oryza sativa subsp. japonica	Aminotransferase ALD1 homolog	63.357%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card