Gene Card
Gene overview
cDNA / CDS / Protein Sequences
861 bp · LXL04_026580|LXL04_026580|OH1004|cDNA
ATGCTTCGATCTCTGTGCGTTACAATAATGGAAGCTCAGTACCTCCAAATTGCCTCAAATCTTCCTCCATTAACAGCGCCAGAAGTTCGAGTAAAAGTCCAGCTAGGGTTTCAATCGTGCGAACAAAGAGAGTTAGAGTGTTTCTCTCTTTCTCCCTCAAATTGGTTGTTAATTTTGATGTACacgtggtggtacagaaaaCGCAGAGATCAGAGGAAGAGTCCCGTTTCGTTACCTGTGACTGTGCTTGATCTAGACGA...
861 bp · LXL04_026580|LXL04_026580|OH1004|CDS
ATGCTTCGATCTCTGTGCGTTACAATAATGGAAGCTCAGTACCTCCAAATTGCCTCAAATCTTCCTCCATTAACAGCGCCAGAAGTTCGAGTAAAAGTCCAGCTAGGGTTTCAATCGTGCGAACAAAGAGAGTTAGAGTGTTTCTCTCTTTCTCCCTCAAATTGGTTGTTAATTTTGATGTACACGTGGTGGTACAGAAAACGCAGAGATCAGAGGAAGAGTCCCGTTTCGTTACCTGTGACTGTGCTTGATCTAGACGA...
Protein
Download Protein FASTA286 aa · LXL04_026580|LXL04_026580|OH1004|PROTEIN
MLRSLCVTIMEAQYLQIASNLPPLTAPEVRVKVQLGFQSCEQRELECFSLSPSNWLLILMYTWWYRKRRDQRKSPVSLPVTVLDLDDDEGCKEEIVEEKKEQKINVDNNSKKDGKSMKKEHALTDFVKHSLVHVRGLKLERMEQQLELGRIYAGASVESGAPEILDLTLFFVCGSSLWKPLSLLHGASSVYLSWCFYLSASRSKEGIQTSVHYRAVLDLIKPRNPTEPYNHVDQETSSSTVTIVVVLQTLIGLDHQSSQD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_026580 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_026580 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr05:128621569-128625544 (+) | ||||||
| Description | Similar to QKY: Protein QUIRKY | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0009911 positive regulation of flower development Biological Process GO:0010497 plasmodesmata-mediated intercellular transport Biological Process GO:0048467 gynoecium development Biological Process GO:0048729 tissue morphogenesis Biological Process GO:0051211 anisotropic cell growth Biological Process GO:0099402 plant organ development Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0046872 metal ion binding Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT1G74720 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
B8XCH5 | Arabidopsis thaliana | Protein QUIRKY | 71.795% | Swiss-Prot | weak database homology |