LXL04_026553 | RubberDandelionOmics

Gene overview

LXL04_026553

Reference: OH-1004 Chr: Chr05 Coordinates: 128147323-128147517 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

195 bp · LXL04_026553|LXL04_026553|OH1004|cDNA

ATGGGAAGACAACCATGTTGCGACAGATTAGGAGTGAAGAAAGGGCCATGGACGGCTGAGGAAGATAGCAAACTCATCAAGTTCATCCTCACCAACGGCCCATGTTGCTGGCGGGCCCTCCCTAAGCTGGCTGGTCTCCGCCGCTGTGGCAAGAGCTGCCGCGCGCCTCCGCTGGACCAACTACCTCCGCCCTGA

CDS

Download CDS FASTA

195 bp · LXL04_026553|LXL04_026553|OH1004|CDS

ATGGGAAGACAACCATGTTGCGACAGATTAGGAGTGAAGAAAGGGCCATGGACGGCTGAGGAAGATAGCAAACTCATCAAGTTCATCCTCACCAACGGCCCATGTTGCTGGCGGGCCCTCCCTAAGCTGGCTGGTCTCCGCCGCTGTGGCAAGAGCTGCCGCGCGCCTCCGCTGGACCAACTACCTCCGCCCTGA

Protein

Download Protein FASTA

64 aa · LXL04_026553|LXL04_026553|OH1004|PROTEIN

MGRQPCCDRLGVKKGPWTAEEDSKLIKFILTNGPCCWRALPKLAGLRRCGKSCRAPPLDQLPPP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026553`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026553

Location Chr05:128147323-128147517 (-)

Description Similar to ODO1: Protein ODORANT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66230`	Transcription factor that acts as a positive regulator of abscisic acid (ABA) signaling in response to salt stress.	An Arabidopsis R2R3-MYB transcription factor, AtMYB20, negatively regulates type 2C serine/threonine protein phosphatases to enhance salt tolerance.2013 · DOI: 10.1016/j.febslet.2013.04.028
`At3g23250`	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance.	A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance.2006 · DOI: 10.1074/jbc.m605895200 Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana.2009 · DOI: 10.1016/s1673-8527(09)60003-5
`At1g06180`	Plays a regulatory role in meristem function.	Isolation of Arabidopsis thaliana cDNAs that confer yeast boric acid tolerance.2006 · DOI: 10.1271/bbb.60065 Ectopic expression of a novel MYB gene modifies the architecture of the Arabidopsis inflorescence.1998 · DOI: 10.1046/j.1365-313x.1998.00072.x
`At2g31180`	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes.	AtMYB14 Regulates Cold Tolerance in Arabidopsis. 2013 · DOI: 10.1007/s11105-012-0481-z

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026553 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009094 L-phenylalanine biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009423 chorismate biosynthetic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

KEGG gene cross-reference

ath:AT1G06180

ath:AT1G66230

ath:AT2G31180

ath:AT3G23250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.632

Rank 1 · LXL04_026553 · OH-1004

Cytoplasm0.278

Rank 2 · LXL04_026553 · OH-1004

Mitochondrion0.064

Rank 3 · LXL04_026553 · OH-1004

Extracellular0.048

Rank 4 · LXL04_026553 · OH-1004

Cell membrane0.026

Rank 5 · LXL04_026553 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding14-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026553	`PF00249.38`	Myb_DNA-binding	14	54	3.7e-11	43.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7U7`	Arabidopsis thaliana	Transcription factor MYB20	74.603%	Swiss-Prot	strong database homology
`Q9LTC4`	Arabidopsis thaliana	Transcription factor MYB15	60.317%	Swiss-Prot	strong database homology
`Q9LNC9`	Arabidopsis thaliana	Transcription factor MYB13	61.905%	Swiss-Prot	strong database homology
`Q9SJX8`	Arabidopsis thaliana	Transcription factor MYB14	60.317%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card