LXL04_026542 | RubberDandelionOmics

Gene overview

LXL04_026542

Reference: OH-1004 Chr: Chr05 Coordinates: 127985728-127987217 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · LXL04_026542|LXL04_026542|OH1004|cDNA

ATGAAGCTTTCCAAATCCTCAATCCAATCCCTAAAACCCAATTTCAAATTCAATCACTTCTCAACCCAAAAACGTCAACTTGACGATGTTGGTCCAATGGCTTCTCTCCTTAAAACCCGATCCGTCGTCCGGTTCAGCGGCCCCGACACAATCAAATTCTTACAAGGCTTATTGACCAACGATATCCGAAAGTTCAGTGAGCCGACGGGTGATGAGAAATCGAGCTTGGTTACCCCAAACGTCCCGGCGTCGTCAGTCCG...

CDS

Download CDS FASTA

1209 bp · LXL04_026542|LXL04_026542|OH1004|CDS

ATGAAGCTTTCCAAATCCTCAATCCAATCCCTAAAACCCAATTTCAAATTCAATCACTTCTCAACCCAAAAACGTCAACTTGACGATGTTGGTCCAATGGCTTCTCTCCTTAAAACCCGATCCGTCGTCCGGTTCAGCGGCCCCGACACAATCAAATTCTTACAAGGCTTATTGACCAACGATATCCGAAAGTTCAGTGAGCCGACGGGTGATGAGAAATCGAGCTTGGTTACCCCAAACGTCCCGGCGTCGTCAGTCCG...

Protein

Download Protein FASTA

402 aa · LXL04_026542|LXL04_026542|OH1004|PROTEIN

MKLSKSSIQSLKPNFKFNHFSTQKRQLDDVGPMASLLKTRSVVRFSGPDTIKFLQGLLTNDIRKFSEPTGDEKSSLVTPNVPASSVRSLYAAMLTPQGRFLYDMFLYEPPRTDEKLDPSGSRPGPEQDNVELLADVDSSVLEELVETLKKYRLRSKVDIENVGDDFSCWQRYGVDHHKRQPSSLEDPEAASVGWGGAIDPTGSSSSQGNSTGWQWHKDPRLDCLGFRGIFPSNTIPPMVAADTETEEENYLMWRLEKGVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026542`
TK1151 ID	TkA06G006320
OH-1004 ID	LXL04_026542
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 95.714 / OH-1004 66.667 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026542

Location Chr05:127985728-127987217 (+)

Description Similar to At4g12130: Putative transferase At4g12130, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12130`	Folate-dependent protein involved in Fe/S cluster biogenesis.	Mitochondrial and plastidial COG0354 proteins have folate-dependent functions in iron-sulphur cluster metabolism.2012 · DOI: 10.1093/jxb/err286

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026542 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006783 heme biosynthetic process Biological Process

GO:0051604 protein maturation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:1990229 iron-sulfur cluster assembly complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0016740 transferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G12130

dre:100330979

hsa:200205

mmu:216792

uma:UMAG_04009

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.906

Rank 1 · LXL04_026542 · OH-1004

Cytoplasm0.079

Rank 2 · LXL04_026542 · OH-1004

Nucleus0.055

Rank 3 · LXL04_026542 · OH-1004

Plastid0.039

Rank 4 · LXL04_026542 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_026542 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25455.3Beta-barrel_CAF17_C307-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026542	`PF25455.3`	Beta-barrel_CAF17_C	307	388	5.9e-16	58.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L733`	Arabidopsis thaliana	Putative transferase At4g12130, mitochondrial	61.741%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card