LXL04_026535 | RubberDandelionOmics

Gene overview

LXL04_026535

Reference: OH-1004 Chr: Chr05 Coordinates: 127903248-127908576 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2064 bp · LXL04_026535|LXL04_026535|OH1004|cDNA

ATGTCGATGTCGGATTCAGATACGTCGTCTCAAGGAGGCAGCGATTATAAAAACTTTAGACAAATTACTCGTGATCGATTACTGTATGAAATGCTGAGAACGGCAAGAAGACCAGATTCAAAATCAAATTGGAAGGTACTGATCATGGATAAAGTGACTGTTAAAATTATGTCATGCTCAAGCAAGATGGCAGACATTACAGATGAAGGAGTTTCATTGGTGGAAGACATAAACAAGAGAAGACAACCACTACCCACTAT...

CDS

Download CDS FASTA

2064 bp · LXL04_026535|LXL04_026535|OH1004|CDS

ATGTCGATGTCGGATTCAGATACGTCGTCTCAAGGAGGCAGCGATTATAAAAACTTTAGACAAATTACTCGTGATCGATTACTGTATGAAATGCTGAGAACGGCAAGAAGACCAGATTCAAAATCAAATTGGAAGGTACTGATCATGGATAAAGTGACTGTTAAAATTATGTCATGCTCAAGCAAGATGGCAGACATTACAGATGAAGGAGTTTCATTGGTGGAAGACATAAACAAGAGAAGACAACCACTACCCACTAT...

Protein

Download Protein FASTA

687 aa · LXL04_026535|LXL04_026535|OH1004|PROTEIN

MSMSDSDTSSQGGSDYKNFRQITRDRLLYEMLRTARRPDSKSNWKVLIMDKVTVKIMSCSSKMADITDEGVSLVEDINKRRQPLPTMDAVYYIQPTKDNVVMLLNDMSGKTPLYRDAYVFFSSSVPRELVNYIKKEQSLKSRLRAMKEMNLEYFAIDSQCFITDNPMVLEELYGNEEMTRKGDECLNMMANRIATVFASLLEFPFVRYRAAKSLDPTTMTTIRDLIPTKLAAAVWNCLMKYKSLKNFNFPQTETCELLIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026535`
TK1151 ID	TkA06G006460
OH-1004 ID	LXL04_026535
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 95.484 / OH-1004 43.086 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026535

Location Chr05:127903248-127908576 (-)

Description Similar to KEU: SNARE-interacting protein KEULE

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12360`	Regulator of vesicle trafficking involved in cytokinesis and root hair development, but not required for cell elongation.	No verified direct reference in this release
`At1g02010`	Involved in the vesicle trafficking.	No verified direct reference in this release
`At4g12120`	Involved in the vesicle trafficking.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0252400`	Involved in the vesicle trafficking.	No verified direct reference in this release
`Os06g0135900`	Involved in the vesicle trafficking.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026535 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0030141 secretory granule Cellular Component

KEGG gene cross-reference

ath:AT1G02010

ath:AT1G12360

ath:AT4G12120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.690

Rank 1 · LXL04_026535 · OH-1004

Cell membrane0.183

Rank 2 · LXL04_026535 · OH-1004

Nucleus0.178

Rank 3 · LXL04_026535 · OH-1004

Golgi apparatus0.132

Rank 4 · LXL04_026535 · OH-1004

Lysosome / Vacuole0.122

Rank 5 · LXL04_026535 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00995.29Sec145-384 aa

PF00995.29Sec1404-670 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026535	`PF00995.29`	Sec1	45	384	2.9e-127	427.0
LXL04_026535	`PF00995.29`	Sec1	404	670	2.9e-127	427.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5X3`	Arabidopsis thaliana	SNARE-interacting protein KEULE	69.764%	Swiss-Prot	strong database homology
`Q9C5P7`	Arabidopsis thaliana	Protein transport Sec1a	63.905%	Swiss-Prot	strong database homology
`Q9SZ77`	Arabidopsis thaliana	Protein transport Sec1b	61.686%	Swiss-Prot	strong database homology
`Q7XWP3`	Oryza sativa subsp. japonica	Probable protein transport Sec1a	64.928%	Swiss-Prot	strong database homology
`Q5VNU3`	Oryza sativa subsp. japonica	Probable protein transport Sec1b	58.971%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card