Gene Card
Gene overview
cDNA / CDS / Protein Sequences
996 bp · LXL04_026523|LXL04_026523|OH1004|cDNA
ATGGTTTCCCCTCCTCCACCGCCGATCGCCGACATCACTGCTTCTCCTTCCTTTCCCCGCTGTTGGTACCCTCCTCCACCGTCGCTAGGCTACGTCGGAGGTAATTTCGGTCGATTTTTGTTCAGTTTAATGTGTCTCGTTCAAAGCTCCTCCACCATCGCTAGCCGTTCAACATCTTCGGGCTTCTCCAACATCTTTCCACACTCGAGCAGAGATGCCAGGGCCAACAATGGAGTTGGAGCTACCAGTAAATGGAAGAA...
996 bp · LXL04_026523|LXL04_026523|OH1004|CDS
ATGGTTTCCCCTCCTCCACCGCCGATCGCCGACATCACTGCTTCTCCTTCCTTTCCCCGCTGTTGGTACCCTCCTCCACCGTCGCTAGGCTACGTCGGAGGTAATTTCGGTCGATTTTTGTTCAGTTTAATGTGTCTCGTTCAAAGCTCCTCCACCATCGCTAGCCGTTCAACATCTTCGGGCTTCTCCAACATCTTTCCACACTCGAGCAGAGATGCCAGGGCCAACAATGGAGTTGGAGCTACCAGTAAATGGAAGAA...
Protein
Download Protein FASTA331 aa · LXL04_026523|LXL04_026523|OH1004|PROTEIN
MVSPPPPPIADITASPSFPRCWYPPPPSLGYVGGNFGRFLFSLMCLVQSSSTIASRSTSSGFSNIFPHSSRDARANNGVGATSKWKNIQKDPEFNHFLYSRSNIDLKDRWRNMSVSANGQGIFNNSSTSALVAQGLNAVALHGGRTQSEREGAFRDFRHGPTNILVATDVASRGLDVTGVAYVVNLDLPKVGISSGAAAAAAIKVGKRPENAEKLIAVVFPTFGERYLSNILFPWLSGHHKKKLKEEFVAWSIEEHFGVV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_026523 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_026523 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:127808289-127810732 (-) | |||||||||
| Description | Similar to Os06g0602400: DEAD-box ATP-dependent RNA helicase 52A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process GO:0000380 alternative mRNA splicing, via spliceosome Biological Process GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0002376 immune system process Biological Process GO:0006364 rRNA processing Biological Process GO:0006417 regulation of translation Biological Process GO:0006535 L-cysteine biosynthetic process from L-serine Biological Process GO:0009567 double fertilization forming a zygote and endosperm Biological Process GO:0009860 pollen tube growth Biological Process GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing Biological Process GO:0050688 regulation of defense response to virus Biological Process | |||||||||
| KEGG gene cross-reference | dme:Dmel_CG10279 dosa:Os03g0805200 dosa:Os06g0602400 pgu:PGUG_04031 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00271.38Helicase_C133-190 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_026523 | PF00271.38 | Helicase_C | 133 | 190 | 3.3e-16 | 60.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.