LXL04_026521 | RubberDandelionOmics

Gene overview

LXL04_026521

Reference: OH-1004 Chr: Chr05 Coordinates: 127728811-127730262 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1452 bp · LXL04_026521|LXL04_026521|OH1004|cDNA

ATGGAAGAAGAAATCTCCCACCGCCCACCGGAGAAACTTCTCAGAGCGGCGGTATCGGAGCTAAAAATACAGCAAGCGATTGCATGTCCATTGATGGCGATGAACTTGACATGGTTTGCCAAGATAGCCATCACCACAGCGTTTCTCGGTCGGCTGGGTGAGCTTGAGTTAGCCAGTGGTGCTCTCGGGTTCATGTTTGCAAACGTCACTGGTTTCTCGGTCTTAAACGGTCTATGTGGTGCCATGGAGCCTATCTGCGG...

CDS

Download CDS FASTA

1452 bp · LXL04_026521|LXL04_026521|OH1004|CDS

ATGGAAGAAGAAATCTCCCACCGCCCACCGGAGAAACTTCTCAGAGCGGCGGTATCGGAGCTAAAAATACAGCAAGCGATTGCATGTCCATTGATGGCGATGAACTTGACATGGTTTGCCAAGATAGCCATCACCACAGCGTTTCTCGGTCGGCTGGGTGAGCTTGAGTTAGCCAGTGGTGCTCTCGGGTTCATGTTTGCAAACGTCACTGGTTTCTCGGTCTTAAACGGTCTATGTGGTGCCATGGAGCCTATCTGCGG...

Protein

Download Protein FASTA

483 aa · LXL04_026521|LXL04_026521|OH1004|PROTEIN

MEEEISHRPPEKLLRAAVSELKIQQAIACPLMAMNLTWFAKIAITTAFLGRLGELELASGALGFMFANVTGFSVLNGLCGAMEPICGQAYGAKNFKLLHKTLVMMVTLLLLTSLPVCFLWLNVDKILIGFGQQEDISTEAKRYLICLLPDLIITSFLCPLKSYMSSQSITIPIMFTSALAVVLHVPVNIFLVKTRGFEGVSMAIWVTDLMVVVMLAVYLAVTEIKKGGTWKEGGWSDQTLLDWVRLLKLSGPCCLTTCLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026521`
TK1151 ID	TkA06G006980
OH-1004 ID	LXL04_026521
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026521

Location Chr05:127728811-127730262 (+)

Description Similar to DTX56: Protein DETOXIFICATION 56

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22790`	May act as an HCO₃⁻-sensing component in guard-cell CO₂ signaling.	A molecular pathway for CO₂ response in Arabidopsis guard cells.2015 · DOI: 10.1038/ncomms7057
`At4g29140`	Functions as a multidrug and toxin extrusion transporter that negatively regulates plant disease resistance.	ADP1 affects plant architecture by regulating local auxin biosynthesis.2014 · DOI: 10.1371/journal.pgen.1003954 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344
`At1g71870`	May function as a multidrug and toxin extrusion transporter in the export of IAA-conjugates from the cytoplasm into peroxisomes.	No verified direct reference in this release
`At5g19700`	May act as a negative regulator of hypocotyl cell elongation in the light.	A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344
`At5g52050`	Functions as a multidrug and toxin extrusion transporter in the export of abscisic acid (ABA) in guard cells.	A DTX/MATE-type transporter facilitates abscisic acid efflux and modulates ABA sensitivity and drought tolerance in Arabidopsis.2014 · DOI: 10.1093/mp/ssu063 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026521 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0046620 regulation of organ growth Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0080168 abscisic acid transport Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

KEGG gene cross-reference

ath:AT1G71870

ath:AT4G22790

ath:AT4G29140

ath:AT5G19700

ath:AT5G52050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.631

Rank 1 · LXL04_026521 · OH-1004

Lysosome / Vacuole0.145

Rank 2 · LXL04_026521 · OH-1004

Endoplasmic reticulum0.104

Rank 3 · LXL04_026521 · OH-1004

Cytoplasm0.082

Rank 4 · LXL04_026521 · OH-1004

Golgi apparatus0.050

Rank 5 · LXL04_026521 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554.24MatE30-189 aa

PF01554.24MatE252-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026521	`PF01554.24`	MatE	30	189	1.3e-59	201.2
LXL04_026521	`PF01554.24`	MatE	252	414	1.3e-59	201.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49660`	Arabidopsis thaliana	Protein DETOXIFICATION 56	59.874%	Swiss-Prot	strong database homology
`Q9SZE2`	Arabidopsis thaliana	Protein DETOXIFICATION 51	37.083%	Swiss-Prot	moderate database homology
`Q9LE20`	Arabidopsis thaliana	Protein DETOXIFICATION 54	37.243%	Swiss-Prot	moderate database homology
`Q4PSF4`	Arabidopsis thaliana	Protein DETOXIFICATION 52	37.581%	Swiss-Prot	moderate database homology
`Q9FJ87`	Arabidopsis thaliana	Protein DETOXIFICATION 50	34.812%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card