LXL04_026471 | RubberDandelionOmics

Gene overview

LXL04_026471

Reference: OH-1004 Chr: Chr05 Coordinates: 126885627-126887728 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1653 bp · LXL04_026471|LXL04_026471|OH1004|cDNA

ATGTCCACCGAACAGAAAGTATCATGGTCGGATTCTTTTTCCCAAGCCCAAACCGCCATCCAATCCCTCTCCACCATCCTCCCCTCCATTCCTTCCCACCTATCCTCCTCCGACACCCCCTCCCTGGACCTCCTAACCGACGTAGAACTCGCCACCCAAGTCTCTGACCACCTCCGGCAACCCGACTCCGGCGCCGGAGACAACCAACTATGCCGCTGGCTCTACGACACCTTCAACACCTCCAAAGTCGACCTCCAACT...

CDS

Download CDS FASTA

1653 bp · LXL04_026471|LXL04_026471|OH1004|CDS

ATGTCCACCGAACAGAAAGTATCATGGTCGGATTCTTTTTCCCAAGCCCAAACCGCCATCCAATCCCTCTCCACCATCCTCCCCTCCATTCCTTCCCACCTATCCTCCTCCGACACCCCCTCCCTGGACCTCCTAACCGACGTAGAACTCGCCACCCAAGTCTCTGACCACCTCCGGCAACCCGACTCCGGCGCCGGAGACAACCAACTATGCCGCTGGCTCTACGACACCTTCAACACCTCCAAAGTCGACCTCCAACT...

Protein

Download Protein FASTA

550 aa · LXL04_026471|LXL04_026471|OH1004|PROTEIN

MSTEQKVSWSDSFSQAQTAIQSLSTILPSIPSHLSSSDTPSLDLLTDVELATQVSDHLRQPDSGAGDNQLCRWLYDTFNTSKVDLQLVVLRFLPIIAGTYLSRVPLRKPLAGFEAVLLTIYAHETTARNGQAITINLPDLSHPSIYHESKQQPHKQTSTDLNLAVISPGLEPQGTIRSTKRARIIGVGLELYNSKIVDMPVQSKLDFCEFCVIWAGQNGEFFKNFPNENNQIEKGKADETNEKQEGRILLPWEMLQPIIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026471`
TK1151 ID	TkA06G011720
OH-1004 ID	LXL04_026471
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 81.283 / OH-1004 27.636 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026471

Location Chr05:126885627-126887728 (+)

Description Similar to At4g11655: CASP-like protein 4A4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11655`	CASP-like protein 4A4.	No verified direct reference in this release
`At5g62820`	CASP-like protein 4A2.	No verified direct reference in this release
`At2g36330`	CASP-like protein 4A3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0134500`	CASP-like protein 4A2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026471 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0030054 cell junction Cellular Component

KEGG gene cross-reference

ath:AT2G36330

ath:AT4G11655

ath:AT5G62820

hsa:285172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.372

Rank 1 · LXL04_026471 · OH-1004

Nucleus0.259

Rank 2 · LXL04_026471 · OH-1004

Endoplasmic reticulum0.222

Rank 3 · LXL04_026471 · OH-1004

Cytoplasm0.196

Rank 4 · LXL04_026471 · OH-1004

Lysosome / Vacuole0.122

Rank 5 · LXL04_026471 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09790.16Hyccin36-313 aa

PF04535.18CASP_dom384-515 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026471	`PF09790.16`	Hyccin	36	313	3.9e-48	164.9
LXL04_026471	`PF04535.18`	CASP_dom	384	515	1.9e-13	51.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EA54`	Arabidopsis thaliana	CASP-like protein 4A4	47.368%	Swiss-Prot	weak database homology
`Q501G6`	Arabidopsis thaliana	CASP-like protein 4A2	30.328%	Swiss-Prot	weak database homology
`Q84WP5`	Arabidopsis thaliana	CASP-like protein 4A3	30.328%	Swiss-Prot	weak database homology
`A3A2W2`	Oryza sativa subsp. japonica	CASP-like protein 4A2	32.258%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card