LXL04_026363 | RubberDandelionOmics

Gene overview

LXL04_026363

Reference: OH-1004 Chr: Chr05 Coordinates: 125209803-125213147 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · LXL04_026363|LXL04_026363|OH1004|cDNA

ATGTATTGCTCGTCGGCGAGGGGGAGAGAAAGAGGAGGGCATCGACTATTCCTGCGTTTTCCGGCGTGTGCTGCTCCTCCTTCTCTGTTCTCCGTCAATCGTGAACCTTCCCAGCAGCCGATTGCAACGACAACAGATCTCATCCTGGGGATGCAAACAGATACTTGGGGATTTCTTCAAGAAGTAGTAGAACAGAATAAAAAACTCGATGATGAATCAGAAAAGAAAAAACAACTCGAGCAAGCTCAAGTACATGGATT...

CDS

Download CDS FASTA

495 bp · LXL04_026363|LXL04_026363|OH1004|CDS

ATGTATTGCTCGTCGGCGAGGGGGAGAGAAAGAGGAGGGCATCGACTATTCCTGCGTTTTCCGGCGTGTGCTGCTCCTCCTTCTCTGTTCTCCGTCAATCGTGAACCTTCCCAGCAGCCGATTGCAACGACAACAGATCTCATCCTGGGGATGCAAACAGATACTTGGGGATTTCTTCAAGAAGTAGTAGAACAGAATAAAAAACTCGATGATGAATCAGAAAAGAAAAAACAACTCGAGCAAGCTCAAGTACATGGATT...

Protein

Download Protein FASTA

164 aa · LXL04_026363|LXL04_026363|OH1004|PROTEIN

MYCSSARGRERGGHRLFLRFPACAAPPSLFSVNREPSQQPIATTTDLILGMQTDTWGFLQEVVEQNKKLDDESEKKKQLEQAQVHGLLHLFGYDHELSEEAEAEMEEEEERLLKNLGWKGKRLIQSALSAESNETLSPKISDCILLLFHIYVCLLKIVIHRFNT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026363`
TK1151 ID	TkA06G014610
OH-1004 ID	LXL04_026363
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026363

Location Chr05:125209803-125213147 (+)

Description Similar to YBEY: Endoribonuclease YBEY, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25870`	Endoribonuclease required for chloroplast ribosomal RNA (rRNA) processing and essential for normal growth and development.	The conserved endoribonuclease YbeY is required for chloroplast ribosomal RNA processing in Arabidopsis.2015 · DOI: 10.1104/pp.114.255000

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026363 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0009658 chloroplast organization Biological Process

GO:1901259 chloroplast rRNA processing Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004222 metalloendopeptidase activity Molecular Function

GO:0004521 RNA endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G25870

avi:Avi_0440

rle:RL0393

rlt:Rleg2_0017

rpe:RPE_0204

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.490

Rank 1 · LXL04_026363 · OH-1004

Nucleus0.344

Rank 2 · LXL04_026363 · OH-1004

Mitochondrion0.176

Rank 3 · LXL04_026363 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_026363 · OH-1004

Cell membrane0.087

Rank 5 · LXL04_026363 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02130.25YbeY61-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026363	`PF02130.25`	YbeY	61	116	6.6e-10	39.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L5Z4`	Arabidopsis thaliana	Endoribonuclease YBEY, chloroplastic	46.602%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card