LXL04_026358 | RubberDandelionOmics

Gene overview

LXL04_026358

Reference: OH-1004 Chr: Chr05 Coordinates: 125154396-125156234 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

777 bp · LXL04_026358|LXL04_026358|OH1004|cDNA

ATGGCGTCAAAGAGACCGCGGTCCACTGAAATCGACGAACAAGTAGTGCAATTGATGAAACGAGCTGAAAGCTCGCCTGTGAAGTTCGATAATTACAATCACAAATCTCCGGTGGTCGTCTTTGCTCATGGAGCTGGTGCTCCTTCTACTTCCGATTGGATGATTAGATGGAGGAACCTGTTAACCAATGCTTTGAATCCTGTAGAAATCGTAACTTTCGATTATCCATACATTTCTGGTAAAAGAAAAGCTGCACCAGA...

CDS

Download CDS FASTA

777 bp · LXL04_026358|LXL04_026358|OH1004|CDS

ATGGCGTCAAAGAGACCGCGGTCCACTGAAATCGACGAACAAGTAGTGCAATTGATGAAACGAGCTGAAAGCTCGCCTGTGAAGTTCGATAATTACAATCACAAATCTCCGGTGGTCGTCTTTGCTCATGGAGCTGGTGCTCCTTCTACTTCCGATTGGATGATTAGATGGAGGAACCTGTTAACCAATGCTTTGAATCCTGTAGAAATCGTAACTTTCGATTATCCATACATTTCTGGTAAAAGAAAAGCTGCACCAGA...

Protein

Download Protein FASTA

258 aa · LXL04_026358|LXL04_026358|OH1004|PROTEIN

MASKRPRSTEIDEQVVQLMKRAESSPVKFDNYNHKSPVVVFAHGAGAPSTSDWMIRWRNLLTNALNPVEIVTFDYPYISGKRKAAPDPEKLVGFHLDFVRKVASKYPEHPLILIGKSLGSRVSCMVAAEKDIKVLGVVCLGYPLKAIKGAIRDEPLLKLTAPIMFVQGSNDSFCPLKLLEVVRKKLKILNELHVIEHGDHSFQIAKKNIELTGLTHQQAEERAAESIAMFVSKIRNEKEKVITQPSSTTISNIMSYEM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026358`
TK1151 ID	TkA06G014300
OH-1004 ID	LXL04_026358
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 98.819 / OH-1004 97.287 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_026358`
Location	Chr05:125154396-125156234 (+)
Description	Similar to kansl3: KAT8 regulatory NSL complex subunit 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026358` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006325 chromatin organization Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:1903108 regulation of mitochondrial transcription Biological Process GO:0000123 histone acetyltransferase complex Cellular Component GO:0000922 spindle pole Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005874 microtubule Cellular Component GO:0044545 NSL complex Cellular Component
KEGG gene cross-reference	dre:555951 hsa:55683 hsa:93081 mmu:226976 rno:316328 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · LXL04_026358 · OH-1004

Nucleus0.366

Rank 2 · LXL04_026358 · OH-1004

Mitochondrion0.104

Rank 3 · LXL04_026358 · OH-1004

Cell membrane0.087

Rank 4 · LXL04_026358 · OH-1004

Endoplasmic reticulum0.071

Rank 5 · LXL04_026358 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20408.5Abhydrolase_1137-231 aa

PF00561.27Abhydrolase_137-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026358	`PF20408.5`	Abhydrolase_11	37	231	1.9e-38	132.8
LXL04_026358	`PF00561.27`	Abhydrolase_1	37	142	4.5e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card