LXL04_026320 | RubberDandelionOmics

Gene overview

LXL04_026320

Reference: OH-1004 Chr: Chr05 Coordinates: 124842440-124845015 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1245 bp · LXL04_026320|LXL04_026320|OH1004|cDNA

ATGGGACGAGGAATAGCAGAAGAGGCGCTAGTACTTGTTCGTAGAAGGCTTTGCGATCCCAATTTCATCTTCTCCCTCTTCTCCGATTCTTCCGATAGCAACTACAGCAAGTTGAAATTTATCGTGTCAAGTTCAGTAACCGAGGCCTGTAACAACTCGATACTGCTCCTGGGACCCCGTGGATGTGGGAAAATTGCGGTATTGGACCTTGTTCTAGAGGATTTGCTTAAAGAATACCCTGAAATGATCACAGtgATTAA...

CDS

Download CDS FASTA

1245 bp · LXL04_026320|LXL04_026320|OH1004|CDS

ATGGGACGAGGAATAGCAGAAGAGGCGCTAGTACTTGTTCGTAGAAGGCTTTGCGATCCCAATTTCATCTTCTCCCTCTTCTCCGATTCTTCCGATAGCAACTACAGCAAGTTGAAATTTATCGTGTCAAGTTCAGTAACCGAGGCCTGTAACAACTCGATACTGCTCCTGGGACCCCGTGGATGTGGGAAAATTGCGGTATTGGACCTTGTTCTAGAGGATTTGCTTAAAGAATACCCTGAAATGATCACAGTGATTAA...

Protein

Download Protein FASTA

414 aa · LXL04_026320|LXL04_026320|OH1004|PROTEIN

MGRGIAEEALVLVRRRLCDPNFIFSLFSDSSDSNYSKLKFIVSSSVTEACNNSILLLGPRGCGKIAVLDLVLEDLLKEYPEMITVIKLNGLLHCDDNCALKEIARQLCIEHELMFSKMASFDDNSQFMIAMLRECGLAHKTVIFILDEFDLFAQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFHPPSKDDIQRLLKHILQLPTDSTLPHDYVTKFNSKISSILADKRFMEVVDKLSDSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026320`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026320

Location Chr05:124842440-124845015 (-)

Description Similar to ORC4: Origin of replication complex subunit 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01120`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0683400`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026320 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0009744 response to sucrose Biological Process

GO:0040038 polar body extrusion after meiotic divisions Biological Process

GO:0051258 protein polymerization Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0000808 origin recognition complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005664 nuclear origin of replication recognition complex Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G01120

bta:529245

cge:100689043

dosa:Os01g0683400

hsa:5000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.743

Rank 1 · LXL04_026320 · OH-1004

Cytoplasm0.300

Rank 2 · LXL04_026320 · OH-1004

Mitochondrion0.033

Rank 3 · LXL04_026320 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_026320 · OH-1004

Golgi apparatus0.015

Rank 5 · LXL04_026320 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13191.13AAA_1646-171 aa

PF13401.13AAA_2252-178 aa

PF00004.36AAA54-200 aa

PF14629.13ORC4_C215-400 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026320	`PF13191.13`	AAA_16	46	171	8e-08	33.7
LXL04_026320	`PF13401.13`	AAA_22	52	178	9.3e-06	26.7
LXL04_026320	`PF00004.36`	AAA	54	200	1.2e-06	29.7
LXL04_026320	`PF14629.13`	ORC4_C	215	400	6e-37	127.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6EWX1`	Arabidopsis thaliana	Origin of replication complex subunit 4	62.440%	Swiss-Prot	strong database homology
`Q5N8Q4`	Oryza sativa subsp. japonica	Origin of replication complex subunit 4	56.667%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card