LXL04_026315 | RubberDandelionOmics

Gene overview

LXL04_026315

Reference: OH-1004 Chr: Chr05 Coordinates: 124821338-124821850 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · LXL04_026315|LXL04_026315|OH1004|cDNA

ATGTCGGGCATCAACGGATTAGCTGACGAAGACGAGAAGAAACCTATTGTTCAGTCGACGCACATCACCATCAAGGTTAATGTTCATCAGCGTGAGAAGCTGGAGTTGTTCTTTAGGATCAAGCGTAACACAAAGCTAAAGAAGTTAGTAGATGCGTGCTGTGACAGACAGTCATTGGAGAAGAAGTTAGTTGATTTTCTTATTGATGGGACACGTTTAAGAGAGGAACAAACTCCTGATGAGCTTGAGATGGAGGAAGG...

CDS

Download CDS FASTA

306 bp · LXL04_026315|LXL04_026315|OH1004|CDS

ATGTCGGGCATCAACGGATTAGCTGACGAAGACGAGAAGAAACCTATTGTTCAGTCGACGCACATCACCATCAAGGTTAATGTTCATCAGCGTGAGAAGCTGGAGTTGTTCTTTAGGATCAAGCGTAACACAAAGCTAAAGAAGTTAGTAGATGCGTGCTGTGACAGACAGTCATTGGAGAAGAAGTTAGTTGATTTTCTTATTGATGGGACACGTTTAAGAGAGGAACAAACTCCTGATGAGCTTGAGATGGAGGAAGG...

Protein

Download Protein FASTA

101 aa · LXL04_026315|LXL04_026315|OH1004|PROTEIN

MSGINGLADEDEKKPIVQSTHITIKVNVHQREKLELFFRIKRNTKLKKLVDACCDRQSLEKKLVDFLIDGTRLREEQTPDELEMEEGDEIDVMLHHDGGGI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026315`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026315

Location Chr05:124821338-124821850 (+)

Description Similar to SUMO2: Small ubiquitin-related modifier 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55160`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer.	Genetic analysis of SUMOylation in Arabidopsis: conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.2007 · DOI: 10.1104/pp.107.102285
`At4g26840`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer.	SIZ1 small ubiquitin-like modifier E3 ligase facilitates basal thermotolerance in Arabidopsis independent of salicylic acid.2006 · DOI: 10.1104/pp.106.088831 Genetic analysis of SUMOylation in Arabidopsis: conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.2007 · DOI: 10.1104/pp.107.102285 Sumoylation of Arabidopsis heat shock factor A2 (HsfA2) modifies its activity during acquired thermotholerance.2010 · DOI: 10.1007/s11103-010-9652-1
`At5g48710`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer.	No verified direct reference in this release
`At5g55856`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0918300`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026315 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0010286 heat acclimation Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0031386 protein tag activity Molecular Function

GO:0044389 ubiquitin-like protein ligase binding Molecular Function

KEGG gene cross-reference

ath:AT4G26840

ath:AT5G48710

ath:AT5G55160

ath:AT5G55856

dosa:Os01g0918300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.720

Rank 1 · LXL04_026315 · OH-1004

Cytoplasm0.417

Rank 2 · LXL04_026315 · OH-1004

Cell membrane0.037

Rank 3 · LXL04_026315 · OH-1004

Mitochondrion0.028

Rank 4 · LXL04_026315 · OH-1004

Endoplasmic reticulum0.022

Rank 5 · LXL04_026315 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240.30ubiquitin22-95 aa

PF11976.15Rad60-SLD24-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026315	`PF00240.30`	ubiquitin	22	95	5.4e-08	33.2
LXL04_026315	`PF11976.15`	Rad60-SLD	24	94	1e-16	61.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLP6`	Arabidopsis thaliana	Small ubiquitin-related modifier 2	60.440%	Swiss-Prot	strong database homology
`P55852`	Arabidopsis thaliana	Small ubiquitin-related modifier 1	57.471%	Swiss-Prot	strong database homology
`Q9FKC5`	Arabidopsis thaliana	Putative small ubiquitin-related modifier 4	39.796%	Swiss-Prot	moderate database homology
`B3H5R8`	Arabidopsis thaliana	Putative small ubiquitin-related modifier 8	39.773%	Swiss-Prot	moderate database homology
`P55857`	Oryza sativa subsp. japonica	Small ubiquitin-related modifier 1	56.842%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card