LXL04_026295 | RubberDandelionOmics

Gene overview

LXL04_026295

Reference: OH-1004 Chr: Chr05 Coordinates: 124511499-124512863 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

876 bp · LXL04_026295|LXL04_026295|OH1004|cDNA

atgGAGACTATCAATAGATCATTACCAGTAGATGATCTTCATCCACCTTCAAACTATGATGATATCTTCATGAAACGCAGCTTGGTATTCGCTGATAGTCTCAAGGATTTGAGGAATATAAGAAAGCAGTTGTACTCAGCTGCAGAGTTTTTCGAAGATTCATATCACAAATCTGATCACGATCAATTATTGGTAGAAAGCTTGAAAGAGTATGTGTCAAAAGCTATAGTTAGCACAATCGACCATTTAGGCTCTGTGGG...

CDS

Download CDS FASTA

876 bp · LXL04_026295|LXL04_026295|OH1004|CDS

ATGGAGACTATCAATAGATCATTACCAGTAGATGATCTTCATCCACCTTCAAACTATGATGATATCTTCATGAAACGCAGCTTGGTATTCGCTGATAGTCTCAAGGATTTGAGGAATATAAGAAAGCAGTTGTACTCAGCTGCAGAGTTTTTCGAAGATTCATATCACAAATCTGATCACGATCAATTATTGGTAGAAAGCTTGAAAGAGTATGTGTCAAAAGCTATAGTTAGCACAATCGACCATTTAGGCTCTGTGGG...

Protein

Download Protein FASTA

291 aa · LXL04_026295|LXL04_026295|OH1004|PROTEIN

METINRSLPVDDLHPPSNYDDIFMKRSLVFADSLKDLRNIRKQLYSAAEFFEDSYHKSDHDQLLVESLKEYVSKAIVSTIDHLGSVGSKVNMFLDENLNEVSEANLRLLCIQQRLQTCQTYSDHDGHLQQSLMIQIPKYHKQYRLPDGSFSEAVQAEKGKEELSSLRRGDMERASTEFQSGSVPFSFAKSESNKGLEKRSRSMSPSRFRIKRSGSAATRSAIMSSPVVSYGSVVQRSISPNTQQHPLEARRSQPSLYPER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026295`
TK1151 ID	TkA06G015950
OH-1004 ID	LXL04_026295
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026295

Location Chr05:124511499-124512863 (-)

Description Similar to ABIL2: Protein ABIL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49290`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`At5g24310`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`At5g42030`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0236400`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`Os01g0551800`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026295 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010090 trichome morphogenesis Biological Process

GO:0048364 root development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

KEGG gene cross-reference

ath:AT3G49290

ath:AT5G24310

ath:AT5G42030

dosa:Os01g0236400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.553

Rank 1 · LXL04_026295 · OH-1004

Nucleus0.375

Rank 2 · LXL04_026295 · OH-1004

Cell membrane0.157

Rank 3 · LXL04_026295 · OH-1004

Endoplasmic reticulum0.050

Rank 4 · LXL04_026295 · OH-1004

Lysosome / Vacuole0.046

Rank 5 · LXL04_026295 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27594.2ABI30-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026295	`PF27594.2`	ABI	30	96	4.2e-11	43.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3A3`	Arabidopsis thaliana	Protein ABIL2	43.279%	Swiss-Prot	moderate database homology
`Q6NMC6`	Arabidopsis thaliana	Protein ABIL3	39.535%	Swiss-Prot	moderate database homology
`Q9FHY1`	Arabidopsis thaliana	Protein ABIL4	38.112%	Swiss-Prot	moderate database homology
`Q5NB83`	Oryza sativa subsp. japonica	Probable protein ABIL3	35.000%	Swiss-Prot	moderate database homology
`Q5JKN2`	Oryza sativa subsp. japonica	Putative protein ABIL2	34.343%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card