LXL04_026290 | RubberDandelionOmics

Gene overview

LXL04_026290

Reference: OH-1004 Chr: Chr05 Coordinates: 124426386-124427574 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

789 bp · LXL04_026290|LXL04_026290|OH1004|cDNA

ATGACTAAATGTTCAAGATCTGTGAAATCTGATGATCAAGCTGAGAAATCTGCTTCCAAGAAAAGGAAGAACCAATACAGAGGAATCCGTCAGCGGTCATGGGGGAAATGGGCTGCCGAGATACGTGATCCAAGGAAAGGCGTCTGTATGTGGCTTGGAACTTTCAATACCGCTGAAGTAGCTGCGAGGGCTTATGACGCCGAGGCCAGAAGGATCCGTGGTGAGAAGGCAAAGGTGAAATTCCCGGAGAAATCTTCACC...

CDS

Download CDS FASTA

789 bp · LXL04_026290|LXL04_026290|OH1004|CDS

ATGACTAAATGTTCAAGATCTGTGAAATCTGATGATCAAGCTGAGAAATCTGCTTCCAAGAAAAGGAAGAACCAATACAGAGGAATCCGTCAGCGGTCATGGGGGAAATGGGCTGCCGAGATACGTGATCCAAGGAAAGGCGTCTGTATGTGGCTTGGAACTTTCAATACCGCTGAAGTAGCTGCGAGGGCTTATGACGCCGAGGCCAGAAGGATCCGTGGTGAGAAGGCAAAGGTGAAATTCCCGGAGAAATCTTCACC...

Protein

Download Protein FASTA

262 aa · LXL04_026290|LXL04_026290|OH1004|PROTEIN

MTKCSRSVKSDDQAEKSASKKRKNQYRGIRQRSWGKWAAEIRDPRKGVCMWLGTFNTAEVAARAYDAEARRIRGEKAKVKFPEKSSPAKPKSQKAKHAAIAEDLPAAKPFIPSETAGFYFSSDQGSNSYDFSDFPWGETCTKTPEITSVLSEVDEANFMEDRPVKKPKTDCVNLVSDCETTSDDLFFEIPYIEGNWNTLSVDAFLNGDSTQDDGNVMDLWSFDDLPVMMNGVFYRYHPFKSAHVFKHVLTGKRMIFNQSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026290`
TK1151 ID	TkA01G474020
OH-1004 ID	LXL04_026290
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	56.100
Protein coverage (%)	TK1151 68.647 / OH-1004 85.496 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026290

Location Chr05:124426386-124427574 (+)

Description Similar to EREBP1: Ethylene-responsive transcription factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14230`	Transcription factor involved in carotenoid biosynthesis regulation.	Arabidopsis RAP2.2: an ethylene response transcription factor that is important for hypoxia survival.2010 · DOI: 10.1104/pp.110.155077
`At1g53910`	Transcription factor involved in the activation of hypoxic gene expression and in ethylene response.	No verified direct reference in this release
`At3g16770`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g72360`	Transcriptional activator involved in the hypoxic stress response.	HRE1 and HRE2, two hypoxia-inducible ethylene response factors, affect anaerobic responses in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2010.04149.x The AP2/ERF transcription factor AtERF73/HRE1 modulates ethylene responses during hypoxia in Arabidopsis.2011 · DOI: 10.1104/pp.111.172486 The hypoxia responsive transcription factor genes ERF71/HRE2 and ERF73/HRE1 of Arabidopsis are differentially regulated by ethylene.2011 · DOI: 10.1111/j.1399-3054.2011.01486.x Arabidopsis HRE1α, a splicing variant of AtERF73/HRE1, functions as a nuclear transcription activator in hypoxia response and root development.2014 · DOI: 10.1007/s00299-014-1613-8 Two Alternative Splicing Variants of AtERF73/HRE1, HRE1α and HRE1β, Have Differential Transactivation Activities in Arabidopsis.2020 · DOI: 10.3390/ijms21196984

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0782700`	Probable transcriptional activator that may be involved in defense signaling pathway.	BWMK1, a rice mitogen-activated protein kinase, locates in the nucleus and mediates pathogenesis-related gene expression by activation of a transcription factor.2003 · DOI: 10.1104/pp.103.023176

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026290 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010286 heat acclimation Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0012501 programmed cell death Biological Process

GO:0034059 response to anoxia Biological Process

KEGG gene cross-reference

ath:AT1G53910

ath:AT1G72360

ath:AT3G14230

ath:AT3G16770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.954

Rank 1 · LXL04_026290 · OH-1004

Cytoplasm0.118

Rank 2 · LXL04_026290 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_026290 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_026290 · OH-1004

Plastid0.014

Rank 5 · LXL04_026290 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP225-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026290	`PF00847.27`	AP2	25	74	1.7e-08	35.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUM4`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-2	42.199%	Swiss-Prot	moderate database homology
`Q9SSA8`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-12	43.985%	Swiss-Prot	moderate database homology
`P42736`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-3	46.763%	Swiss-Prot	weak database homology
`Q8H0T5`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF073	38.967%	Swiss-Prot	moderate database homology
`Q6K7E6`	Oryza sativa subsp. japonica	Ethylene-responsive transcription factor 1	42.803%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card