LXL04_026284 | RubberDandelionOmics

Gene overview

LXL04_026284

Reference: OH-1004 Chr: Chr05 Coordinates: 124346701-124347752 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

828 bp · LXL04_026284|LXL04_026284|OH1004|cDNA

ATGGGAAGGGCACCCTGTTGTGCGAAGGTCGGTTTACACAGAGGAGCATGGTCTGATGAAGAAGATAAACTCCTCACACACTACATTCAAACCAACGGTGAAGGTCAATGGCGCTCTTTGCCTTCCAAAGCTGGATTACTTAGATGCGGAAAGAGCTGTAGGCTGAGATGGATGAATTACCTCCGGCCAGGTATCAAGCGAGGAAACTTCACCGCCGATGAGAATGAAATCATCATCCGGCTCCATTCTGTCCATGGTAA...

CDS

Download CDS FASTA

828 bp · LXL04_026284|LXL04_026284|OH1004|CDS

ATGGGAAGGGCACCCTGTTGTGCGAAGGTCGGTTTACACAGAGGAGCATGGTCTGATGAAGAAGATAAACTCCTCACACACTACATTCAAACCAACGGTGAAGGTCAATGGCGCTCTTTGCCTTCCAAAGCTGGATTACTTAGATGCGGAAAGAGCTGTAGGCTGAGATGGATGAATTACCTCCGGCCAGGTATCAAGCGAGGAAACTTCACCGCCGATGAGAATGAAATCATCATCCGGCTCCATTCTGTCCATGGTAA...

Protein

Download Protein FASTA

275 aa · LXL04_026284|LXL04_026284|OH1004|PROTEIN

MGRAPCCAKVGLHRGAWSDEEDKLLTHYIQTNGEGQWRSLPSKAGLLRCGKSCRLRWMNYLRPGIKRGNFTADENEIIIRLHSVHGNRWSFIATELPGRTDNEIKNHWNSHLKRKSRGDDGGDENQETVSKTNKKPKKKRKTEQKSTKPKITEKPVEIVPLPQPTSTSSSSSLSSSQSAPLTMRKNDSFDNGVMSGASSSSQSDQGETDLLASDFSWPNWTPLFEMEVAGTIDVHDNHDLPLDTCDLLMSNDEESEMLEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026284`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026284

Location Chr05:124346701-124347752 (+)

Description Similar to MYB111: Transcription factor MYB111

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49330`	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis.	Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.2007 · DOI: 10.1111/j.1365-313x.2007.03078.x The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation.2010 · DOI: 10.1111/j.1365-3040.2009.02061.x Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.2010 · DOI: 10.1111/j.1469-8137.2010.03421.x
`At3g23250`	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance.	A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance.2006 · DOI: 10.1074/jbc.m605895200 Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana.2009 · DOI: 10.1016/s1673-8527(09)60003-5
`At2g16720`	Transcription factor involved in the negative regulation of flavonol biosynthesis.	AtMYB7, a new player in the regulation of UV-sunscreens in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pct187 AtMyb7, a subgroup 4 R2R3 Myb, negatively regulates ABA-induced inhibition of seed germination by blocking the expression of the bZIP transcription factor ABI5.2015 · DOI: 10.1111/pce.12415

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026284 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0010224 response to UV-B Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:1900384 regulation of flavonol biosynthetic process Biological Process

GO:1900386 positive regulation of flavonol biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G16720

ath:AT3G23250

ath:AT5G49330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · LXL04_026284 · OH-1004

Cytoplasm0.160

Rank 2 · LXL04_026284 · OH-1004

Mitochondrion0.021

Rank 3 · LXL04_026284 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_026284 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_026284 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding14-61 aa

PF13921.13Myb_DNA-bind_617-74 aa

PF00249.38Myb_DNA-binding67-112 aa

PF13921.13Myb_DNA-bind_670-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026284	`PF00249.38`	Myb_DNA-binding	14	61	3.9e-34	117.2
LXL04_026284	`PF13921.13`	Myb_DNA-bind_6	17	74	2e-18	67.0
LXL04_026284	`PF00249.38`	Myb_DNA-binding	67	112	3.9e-34	117.2
LXL04_026284	`PF13921.13`	Myb_DNA-bind_6	70	117	2e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ07`	Arabidopsis thaliana	Transcription factor MYB111	77.391%	Swiss-Prot	weak database homology
`Q9LTC4`	Arabidopsis thaliana	Transcription factor MYB15	48.969%	Swiss-Prot	moderate database homology
`Q42379`	Arabidopsis thaliana	Transcription factor MYB7	68.033%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card