LXL04_026257 | RubberDandelionOmics

Gene overview

LXL04_026257

Reference: OH-1004 Chr: Chr05 Coordinates: 123981517-123984122 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · LXL04_026257|LXL04_026257|OH1004|cDNA

ATGGAAGATATATCCATTGATTCAACAATATCTACGAACCATGACCGGTCGGAATCACAAAATGGCGACACGGAACACAATCCAGATCCCAATTCCATATCCCCTCCGCCTGAAGACGCTGCGATCCAATCAACGGACGGACAATCGCCTGGCAACGATGCAGGTGAGCCTTCGAAGCTTGACCAATTCATTCAGTCCAGTGATACAGATGTGAATACGACCAATGTTGATCCCGAACCGCCAAAAGAACCTGCAATTAC...

CDS

Download CDS FASTA

1533 bp · LXL04_026257|LXL04_026257|OH1004|CDS

ATGGAAGATATATCCATTGATTCAACAATATCTACGAACCATGACCGGTCGGAATCACAAAATGGCGACACGGAACACAATCCAGATCCCAATTCCATATCCCCTCCGCCTGAAGACGCTGCGATCCAATCAACGGACGGACAATCGCCTGGCAACGATGCAGGTGAGCCTTCGAAGCTTGACCAATTCATTCAGTCCAGTGATACAGATGTGAATACGACCAATGTTGATCCCGAACCGCCAAAAGAACCTGCAATTAC...

Protein

Download Protein FASTA

510 aa · LXL04_026257|LXL04_026257|OH1004|PROTEIN

MEDISIDSTISTNHDRSESQNGDTEHNPDPNSISPPPEDAAIQSTDGQSPGNDAGEPSKLDQFIQSSDTDVNTTNVDPEPPKEPAITALDKEEVKPSVTMIELLGELKNPDVNIEDSPTAVVATPSRSQENKQPKGRNSAAMALINSLASSDEEGRTRQRMLKFAAKRYASAIESNPDDYDALYNWALVLQESADNVSSDTNSPSKDALLEEACKKYAEATNLNPALHDAYYNWAIAISDRAKLHGRTKEAEELWKQATK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026257`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026257

Location Chr05:123981517-123984122 (+)

Description Similar to HLB1: Protein HLB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41950`	Component of the endomembrane trafficking machinery that is involved in protein recycling to the plasma membrane.	HLB1 Is a Tetratricopeptide Repeat Domain-Containing Protein That Operates at the Intersection of the Exocytic and Endocytic Pathways at the TGN/EE in Arabidopsis.2016 · DOI: 10.1105/tpc.15.00794

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026257 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0048767 root hair elongation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0080147 root hair cell development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT5G41950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.505

Rank 1 · LXL04_026257 · OH-1004

Nucleus0.273

Rank 2 · LXL04_026257 · OH-1004

Cell membrane0.168

Rank 3 · LXL04_026257 · OH-1004

Golgi apparatus0.152

Rank 4 · LXL04_026257 · OH-1004

Lysosome / Vacuole0.088

Rank 5 · LXL04_026257 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06552.19TOM20_plant169-266 aa

PF06552.19TOM20_plant255-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026257	`PF06552.19`	TOM20_plant	169	266	1.9e-11	44.8
LXL04_026257	`PF06552.19`	TOM20_plant	255	326	1.9e-11	44.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHY8`	Arabidopsis thaliana	Protein HLB1	67.606%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card