LXL04_026193 | RubberDandelionOmics

Gene overview

LXL04_026193

Reference: OH-1004 Chr: Chr05 Coordinates: 122555071-122556882 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · LXL04_026193|LXL04_026193|OH1004|cDNA

ATGGTTGGTTTAGAGATGAACGACTGGAAAAAGATCGGGTTGGGATTGACTGGATTTGGCATCTTTTTCTCGTTTTTGGGAATCATTTTCTTCTTTGACAAAGGACTACTCGCCATTGGAAATATCCTATTCATCTCAGGAGTGATAATGACCATTGGAGTCAAGCCCTCCTTACAGTTCTTCATGAAACGCACCAACTTTAAGGGCACAATTTCATTTAGTGTTGGCTTCTTCTTTGTTATCATTGGGTGGCCTGTAAT...

CDS

Download CDS FASTA

432 bp · LXL04_026193|LXL04_026193|OH1004|CDS

ATGGTTGGTTTAGAGATGAACGACTGGAAAAAGATCGGGTTGGGATTGACTGGATTTGGCATCTTTTTCTCGTTTTTGGGAATCATTTTCTTCTTTGACAAAGGACTACTCGCCATTGGAAATATCCTATTCATCTCAGGAGTGATAATGACCATTGGAGTCAAGCCCTCCTTACAGTTCTTCATGAAACGCACCAACTTTAAGGGCACAATTTCATTTAGTGTTGGCTTCTTCTTTGTTATCATTGGGTGGCCTGTAAT...

Protein

Download Protein FASTA

143 aa · LXL04_026193|LXL04_026193|OH1004|PROTEIN

MVGLEMNDWKKIGLGLTGFGIFFSFLGIIFFFDKGLLAIGNILFISGVIMTIGVKPSLQFFMKRTNFKGTISFSVGFFFVIIGWPVIGMAAEAYGFIILFSGFWPTLSVFVQKIPVIGWIFQQPYLRSVCFPCPCKCCSFLRP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026193`
TK1151 ID	TkA06G021930
OH-1004 ID	LXL04_026193
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026193

Location Chr05:122555071-122556882 (+)

Description Similar to GOT1: Vesicle transport protein GOT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03180`	May be involved in fusion of ER-derived transport vesicles with the Golgi complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026193 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0015031 protein transport Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0048193 Golgi vesicle transport Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G03180

bta:508464

cel:CELE_F41C3.4

hsa:127845

mmu:68338

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.525

Rank 1 · LXL04_026193 · OH-1004

Endoplasmic reticulum0.352

Rank 2 · LXL04_026193 · OH-1004

Cytoplasm0.187

Rank 3 · LXL04_026193 · OH-1004

Lysosome / Vacuole0.077

Rank 4 · LXL04_026193 · OH-1004

Cell membrane0.069

Rank 5 · LXL04_026193 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04178.19Got116-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026193	`PF04178.19`	Got1	16	115	1.3e-11	45.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NMM1`	Arabidopsis thaliana	Vesicle transport protein GOT1	66.923%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card