LXL04_026170 | RubberDandelionOmics

Gene overview

LXL04_026170

Reference: OH-1004 Chr: Chr05 Coordinates: 122121052-122125297 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1866 bp · LXL04_026170|LXL04_026170|OH1004|cDNA

ATGGTGGTTGAAATTGTGGTGATGATGTTTGTGATTGTGGTGACAGTGTTTGAAATTGTGGGGacggtgtttgaaattgagggagcggtgtttgatactgtggttgtggtgactgatactgatactgtgGTGTGTGATACTGCGGTGTGGGATACTGCGGTGCTTGATACTGATACTGTGTTTGCATCTATGGTTGAAACGCCAGCTGTTGTTGCTGTAGCAGAGGATCAAATGTTGGGCGGTATCCCTCTTGTTGCGGA...

CDS

Download CDS FASTA

1866 bp · LXL04_026170|LXL04_026170|OH1004|CDS

ATGGTGGTTGAAATTGTGGTGATGATGTTTGTGATTGTGGTGACAGTGTTTGAAATTGTGGGGACGGTGTTTGAAATTGAGGGAGCGGTGTTTGATACTGTGGTTGTGGTGACTGATACTGATACTGTGGTGTGTGATACTGCGGTGTGGGATACTGCGGTGCTTGATACTGATACTGTGTTTGCATCTATGGTTGAAACGCCAGCTGTTGTTGCTGTAGCAGAGGATCAAATGTTGGGCGGTATCCCTCTTGTTGCGGA...

Protein

Download Protein FASTA

621 aa · LXL04_026170|LXL04_026170|OH1004|PROTEIN

MVVEIVVMMFVIVVTVFEIVGTVFEIEGAVFDTVVVVTDTDTVVCDTAVWDTAVLDTDTVFASMVETPAVVAVAEDQMLGGIPLVAEAFSAAWGCRPSLRWQTLLLPTATPRASPAIDRFNKKARAFMEKTKRSPGIICRKVWKVGRDDPRRAIHALKVGFSLTLVSLLYLMEPLFKGVGENAIWAVMTVVVVLEFTAGATLCKGINRGFGTLLAASLAFIFEFIAREYGKVFRAVFIGASIFFIGTSTTYLRFFPKIKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026170`
TK1151 ID	TkA06G023260
OH-1004 ID	LXL04_026170
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 99.606 / OH-1004 81.320 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026170

Location Chr05:122121052-122125297 (+)

Description Similar to ALMT12: Aluminum-activated malate transporter 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17970`	Malate-sensitive anion transporter permeable to chloride, nitrate, sulfate and malate.	Closing plant stomata requires a homolog of an aluminum-activated malate transporter.2010 · DOI: 10.1093/pcp/pcq016 AtALMT12 represents an R-type anion channel required for stomatal movement in Arabidopsis guard cells.2010 · DOI: 10.1111/j.1365-313x.2010.04302.x
`At5g46610`	Malate transporter.	No verified direct reference in this release
`At5g46600`	Malate transporter.	No verified direct reference in this release
`At4g00910`	Malate transporter.	No verified direct reference in this release
`At1g08440`	Malate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026170 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010118 stomatal movement Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0008509 monoatomic anion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G08440

ath:AT4G17970

ath:AT5G46600

ath:AT5G46610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.809

Rank 1 · LXL04_026170 · OH-1004

Endoplasmic reticulum0.121

Rank 2 · LXL04_026170 · OH-1004

Cytoplasm0.072

Rank 3 · LXL04_026170 · OH-1004

Nucleus0.044

Rank 4 · LXL04_026170 · OH-1004

Lysosome / Vacuole0.040

Rank 5 · LXL04_026170 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744.15ALMT143-585 aa

PF13515.13FUSC_2181-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026170	`PF11744.15`	ALMT	143	585	1.7e-156	522.6
LXL04_026170	`PF13515.13`	FUSC_2	181	306	1.1e-10	42.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49696`	Arabidopsis thaliana	Aluminum-activated malate transporter 12	57.383%	Swiss-Prot	strong database homology
`Q9LS22`	Arabidopsis thaliana	Aluminum-activated malate transporter 14	59.470%	Swiss-Prot	strong database homology
`Q9LS23`	Arabidopsis thaliana	Aluminum-activated malate transporter 13	54.264%	Swiss-Prot	strong database homology
`O23086`	Arabidopsis thaliana	Aluminum-activated malate transporter 10	35.546%	Swiss-Prot	moderate database homology
`Q9SJE8`	Arabidopsis thaliana	Aluminum-activated malate transporter 2	38.547%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card