LXL04_026160 | RubberDandelionOmics

Gene overview

LXL04_026160

Reference: OH-1004 Chr: Chr05 Coordinates: 122021390-122024052 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1317 bp · LXL04_026160|LXL04_026160|OH1004|cDNA

ATGCCGGTGGCTGCTTCCGCCATCTACTTCCTAAATCTTCGCGGCGATGTCCTCATCAATCGTCTTTATCGCGATGATGTTGGGGGAAATATGGTTGATGCCTTTAGAATGCACATAATGCAAACAAAGGAACTAGGGACATGTCCTGTGAGGCAGATTGGGGGTTGCTCTTTCTTCTATATGAGAATTAGCAATGTCTATATTGTGATTGTTGTCAGCAGCAATGCCAATGTAGCCTGTGCCTTCAAATTTGTTGTTGA...

CDS

Download CDS FASTA

1317 bp · LXL04_026160|LXL04_026160|OH1004|CDS

ATGCCGGTGGCTGCTTCCGCCATCTACTTCCTAAATCTTCGCGGCGATGTCCTCATCAATCGTCTTTATCGCGATGATGTTGGGGGAAATATGGTTGATGCCTTTAGAATGCACATAATGCAAACAAAGGAACTAGGGACATGTCCTGTGAGGCAGATTGGGGGTTGCTCTTTCTTCTATATGAGAATTAGCAATGTCTATATTGTGATTGTTGTCAGCAGCAATGCCAATGTAGCCTGTGCCTTCAAATTTGTTGTTGA...

Protein

Download Protein FASTA

438 aa · LXL04_026160|LXL04_026160|OH1004|PROTEIN

MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFYMRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKPTDKPVPNATLQVTGAVGWRREGLSYKKNEVFLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESEIKSRPTKSGKTIELDDVTFHQCVNLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026160`
TK1151 ID	TkA06G023850
OH-1004 ID	LXL04_026160
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026160

Location Chr05:122021390-122024052 (-)

Description Similar to AP2M: AP-2 complex subunit mu

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46630`	Subunit of the adaptor protein complex 2 (AP-2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026160 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002092 positive regulation of receptor internalization Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0006900 vesicle budding from membrane Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0031623 receptor internalization Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:0072583 clathrin-dependent endocytosis Biological Process

GO:0097494 regulation of vesicle size Biological Process

GO:1903077 negative regulation of protein localization to plasma membrane Biological Process

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT5G46630

ddi:DDB_G0277139

mmu:11773

rno:116563

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.551

Rank 1 · LXL04_026160 · OH-1004

Golgi apparatus0.372

Rank 2 · LXL04_026160 · OH-1004

Cell membrane0.227

Rank 3 · LXL04_026160 · OH-1004

Nucleus0.131

Rank 4 · LXL04_026160 · OH-1004

Endoplasmic reticulum0.106

Rank 5 · LXL04_026160 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00928.27Adap_comp_sub167-438 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026160	`PF00928.27`	Adap_comp_sub	167	438	1e-94	317.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23140`	Arabidopsis thaliana	AP-2 complex subunit mu	95.205%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card