LXL04_026129 | RubberDandelionOmics

Gene overview

LXL04_026129

Reference: OH-1004 Chr: Chr05 Coordinates: 121348924-121349946 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · LXL04_026129|LXL04_026129|OH1004|cDNA

ATGGCGGAAGTGACGGCGAAGCGATATAGTGTGGGTTACGCACTGTTACAGAAGAAACAACGCAGCTTTGTTCAGTGTTCTTTATTGACTTTAGCTAAAGAACGCGGTATTGATCTCATTAGGATCGACACCGACAAGCCACTATTGGATCAAGGCCCTTTTGATTGTGTGCTTCACAAGATGAACGGTGAAAACTGGCGGAAGCAGCTAAAGGAGTACTCCGGTCGGAACCCTAGCAGTTACATAATCGATTCCCCTGA...

CDS

Download CDS FASTA

1023 bp · LXL04_026129|LXL04_026129|OH1004|CDS

ATGGCGGAAGTGACGGCGAAGCGATATAGTGTGGGTTACGCACTGTTACAGAAGAAACAACGCAGCTTTGTTCAGTGTTCTTTATTGACTTTAGCTAAAGAACGCGGTATTGATCTCATTAGGATCGACACCGACAAGCCACTATTGGATCAAGGCCCTTTTGATTGTGTGCTTCACAAGATGAACGGTGAAAACTGGCGGAAGCAGCTAAAGGAGTACTCCGGTCGGAACCCTAGCAGTTACATAATCGATTCCCCTGA...

Protein

Download Protein FASTA

340 aa · LXL04_026129|LXL04_026129|OH1004|PROTEIN

MAEVTAKRYSVGYALLQKKQRSFVQCSLLTLAKERGIDLIRIDTDKPLLDQGPFDCVLHKMNGENWRKQLKEYSGRNPSSYIIDSPDAIQRLQNRISMLEVVSEIEAAEVKLKDGESASFGTPKQTVIYEQEKLNDTTSWGEGLKFPVIAKPLVADGSMKSHKMSLIFSSEGLDKLKPPTVLQEFVNHGGVIFKVYVVGEYVKCVRRKSLADITDEKLGSLQGSVPFCQVSNMTSHPKNDDTYYKNLEDAEMPPMSLITA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026129`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026129

Location Chr05:121348924-121349946 (+)

Description Similar to ITPK1: Inositol-tetrakisphosphate 1-kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16760`	Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0576100`	Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3 and participates in phytic acid biosynthesis in developing seeds.	No verified direct reference in this release
`UniProt: A0JJZ6`	Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3 and participates in phytic acid biosynthesis in developing seeds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026129 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010264 myo-inositol hexakisphosphate biosynthetic process Biological Process

GO:0032957 inositol trisphosphate metabolic process Biological Process

GO:0048316 seed development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0000825 inositol-1,3,4,5-tetrakisphosphate 6-kinase activity Molecular Function

GO:0000832 inositol hexakisphosphate 5-kinase activity Molecular Function

GO:0005102 signaling receptor binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0047325 inositol-3,4,5,6-tetrakisphosphate 1-kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G16760

dosa:Os10g0576100

gmx:100127430

zma:732818

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.664

Rank 1 · LXL04_026129 · OH-1004

Nucleus0.415

Rank 2 · LXL04_026129 · OH-1004

Mitochondrion0.060

Rank 3 · LXL04_026129 · OH-1004

Cell membrane0.059

Rank 4 · LXL04_026129 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_026129 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17927.8Ins134_P3_kin_N11-89 aa

PF05770.17Ins134_P3_kin117-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026129	`PF17927.8`	Ins134_P3_kin_N	11	89	2.6e-28	99.0
LXL04_026129	`PF05770.17`	Ins134_P3_kin	117	315	3e-79	265.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SBA5`	Arabidopsis thaliana	Inositol-tetrakisphosphate 1-kinase 1	54.062%	Swiss-Prot	strong database homology
`Q7XBW0`	Oryza sativa subsp. japonica	Inositol-tetrakisphosphate 1-kinase 5	54.545%	Swiss-Prot	strong database homology
`A0JJZ6`	Oryza sativa subsp. indica	Inositol-tetrakisphosphate 1-kinase 5	54.545%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card