LXL04_026103 | RubberDandelionOmics

Gene overview

LXL04_026103

Reference: OH-1004 Chr: Chr05 Coordinates: 120921882-120923784 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · LXL04_026103|LXL04_026103|OH1004|cDNA

ATGTCTCTCCTCTTCTCCCACAACCCAACACTCCTCTTCGAGAACTcggccaccaccgccaccaccgccaccaccaccacaacAGCCACTTCCTCCATGCTCCACTGCTTTGCCCCTAATTCCCTATCTTTCTTAATCCGTCCCAGAAGAATCAAATCGACATTCATTCGGTGTTCCTCAAACAATCCCCCAACCACCCCTGGATGGAACCCCGCTGACCAGACAGTCAACGACGACGAAGAATCCGACAGGTCTCAATC...

CDS

Download CDS FASTA

1143 bp · LXL04_026103|LXL04_026103|OH1004|CDS

ATGTCTCTCCTCTTCTCCCACAACCCAACACTCCTCTTCGAGAACTCGGCCACCACCGCCACCACCGCCACCACCACCACAACAGCCACTTCCTCCATGCTCCACTGCTTTGCCCCTAATTCCCTATCTTTCTTAATCCGTCCCAGAAGAATCAAATCGACATTCATTCGGTGTTCCTCAAACAATCCCCCAACCACCCCTGGATGGAACCCCGCTGACCAGACAGTCAACGACGACGAAGAATCCGACAGGTCTCAATC...

Protein

Download Protein FASTA

380 aa · LXL04_026103|LXL04_026103|OH1004|PROTEIN

MSLLFSHNPTLLFENSATTATTATTTTTATSSMLHCFAPNSLSFLIRPRRIKSTFIRCSSNNPPTTPGWNPADQTVNDDEESDRSQSPTVTDEWGEKSEPELEPLTNLSTSDPPKDEDEWGNGNGATEQPKEEISVAGNGSPAVEATGFEDNGKIEDLKRCLVDTVYGTGLGFRASPEERAEIMELVTQLEGINPTPAPTDAVELLDGNWILLYTAFSELLPLLAVGTTPLLKVDQISQQVSTTNLTIDNSITFSTPFAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026103`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026103

Location Chr05:120921882-120923784 (-)

Description Similar to PAP3: Probable plastid-lipid-associated protein 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35490`	Probably involved in light/cold stress-related jasmonate (JA) biosynthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0575700`	Probable plastid-lipid-associated protein 3, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026103 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009753 response to jasmonic acid Biological Process

GO:0010117 photoprotection Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0010287 plastoglobule Cellular Component

KEGG gene cross-reference

ath:AT2G35490

dosa:Os10g0575700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.989

Rank 1 · LXL04_026103 · OH-1004

Cytoplasm0.021

Rank 2 · LXL04_026103 · OH-1004

Mitochondrion0.020

Rank 3 · LXL04_026103 · OH-1004

Peroxisome0.017

Rank 4 · LXL04_026103 · OH-1004

Nucleus0.017

Rank 5 · LXL04_026103 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04755.19PAP_fibrillin157-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026103	`PF04755.19`	PAP_fibrillin	157	372	6.7e-69	232.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82291`	Arabidopsis thaliana	Probable plastid-lipid-associated protein 3, chloroplastic	54.830%	Swiss-Prot	strong database homology
`Q7XBW5`	Oryza sativa subsp. japonica	Probable plastid-lipid-associated protein 3, chloroplastic	57.377%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card