LXL04_026089 | RubberDandelionOmics

Gene overview

LXL04_026089

Reference: OH-1004 Chr: Chr05 Coordinates: 120751234-120753596 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · LXL04_026089|LXL04_026089|OH1004|cDNA

ATGGATGGCAGGTacggcggcggcggtggtggtggtggcggtgggtGTTTTGAGTTTGATAGTGGTGGGGTGGTGATGACAAGAGACCCAAAGCCACGGCTCCGATGGACGGCTGATCTTCATGATAGATTTGTTGACGCTGTTACGAAACTTGGTGGCCCTGATAAAGCGACCCCAAAATCGGTGTTGAGATTGATGGGATTAAAGGGGTTGACATTGTACCATTTGAAGAGCCATTTACAGAAGTATAGACTTGGACA...

CDS

Download CDS FASTA

855 bp · LXL04_026089|LXL04_026089|OH1004|CDS

ATGGATGGCAGGTACGGCGGCGGCGGTGGTGGTGGTGGCGGTGGGTGTTTTGAGTTTGATAGTGGTGGGGTGGTGATGACAAGAGACCCAAAGCCACGGCTCCGATGGACGGCTGATCTTCATGATAGATTTGTTGACGCTGTTACGAAACTTGGTGGCCCTGATAAAGCGACCCCAAAATCGGTGTTGAGATTGATGGGATTAAAGGGGTTGACATTGTACCATTTGAAGAGCCATTTACAGAAGTATAGACTTGGACA...

Protein

Download Protein FASTA

284 aa · LXL04_026089|LXL04_026089|OH1004|PROTEIN

MDGRYGGGGGGGGGGCFEFDSGGVVMTRDPKPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRLGQQAKKQIGDPNNENSGDSYEHYNLHSTGTSSNSLRANHEQVYASSITDIPIADALLCQIEAQKRLQEQFEVQKKLQMRIETQGKYLQGILENAQKSLSLDMNSSGNLEATRAELTNFNLALSDLMDNLNGEGREENVSKFSHDVKKGPTITHVKEEMKIKTEGGGGGGSISFDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026089`
TK1151 ID	TkA06G028000
OH-1004 ID	LXL04_026089
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026089

Location Chr05:120751234-120753596 (+)

Description Similar to PHL11: Myb family transcription factor PHL11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45580`	Myb family transcription factor PHL11.	No verified direct reference in this release
`At3g24120`	Transcriptional activator.	Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation.2016 · DOI: 10.1104/pp.15.01336
`At4g13640`	Transcriptional activator.	Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation.2016 · DOI: 10.1104/pp.15.01336
`At1g79430`	Transcription factor required for phloem identity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026089 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009877 nodulation Biological Process

GO:0009908 flower development Biological Process

GO:0010088 phloem development Biological Process

GO:0010089 xylem development Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

KEGG gene cross-reference

ath:AT1G79430

ath:AT3G24120

ath:AT4G13640

ath:AT5G45580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · LXL04_026089 · OH-1004

Cytoplasm0.075

Rank 2 · LXL04_026089 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_026089 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_026089 · OH-1004

Plastid0.009

Rank 5 · LXL04_026089 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding33-84 aa

PF14379.12Myb_CC_LHEQLE136-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026089	`PF00249.38`	Myb_DNA-binding	33	84	1.4e-08	35.4
LXL04_026089	`PF14379.12`	Myb_CC_LHEQLE	136	181	1.2e-20	73.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0SVS4`	Arabidopsis thaliana	Myb family transcription factor PHL11	51.923%	Swiss-Prot	strong database homology
`Q94A57`	Arabidopsis thaliana	Protein PHR1-LIKE 2	53.723%	Swiss-Prot	moderate database homology
`Q8LAJ7`	Arabidopsis thaliana	Protein PHR1-LIKE 3	53.968%	Swiss-Prot	moderate database homology
`Q9SAK5`	Arabidopsis thaliana	Myb family transcription factor APL	52.663%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card