LXL04_025988 | RubberDandelionOmics

Gene overview

LXL04_025988

Reference: OH-1004 Chr: Chr05 Coordinates: 119413198-119416207 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1512 bp · LXL04_025988|LXL04_025988|OH1004|cDNA

ATGCTGTTATCTCGCCGTATTCTTCGTGGAAGATCCTGGAACGCCGGTAGGAGCTGTTTGTGTTATCTCACTTCCACACCTTCAACGACGGCGGTGACGACTGAGCTGAAGCCTAATACAATCGCCCAATTCTCAAGCGCATCTTCAACTTCTGCAAAGTTGAAGTTCGACGGCTCTTACAAGTTAAACAACTGGTACAATGTCAGTGGGCGCTACTTTTCAACAAATGCAGTAAATAGTCAACCAACTGATGGTATCAT...

CDS

Download CDS FASTA

1512 bp · LXL04_025988|LXL04_025988|OH1004|CDS

ATGCTGTTATCTCGCCGTATTCTTCGTGGAAGATCCTGGAACGCCGGTAGGAGCTGTTTGTGTTATCTCACTTCCACACCTTCAACGACGGCGGTGACGACTGAGCTGAAGCCTAATACAATCGCCCAATTCTCAAGCGCATCTTCAACTTCTGCAAAGTTGAAGTTCGACGGCTCTTACAAGTTAAACAACTGGTACAATGTCAGTGGGCGCTACTTTTCAACAAATGCAGTAAATAGTCAACCAACTGATGGTATCAT...

Protein

Download Protein FASTA

503 aa · LXL04_025988|LXL04_025988|OH1004|PROTEIN

MLLSRRILRGRSWNAGRSCLCYLTSTPSTTAVTTELKPNTIAQFSSASSTSAKLKFDGSYKLNNWYNVSGRYFSTNAVNSQPTDGIIDVPLAQTGEGIAECELLKWFVLEGEQVEEYQPLCEVQSDKATIEITSRYKGKVSKILHTPGDIIKVGETLLQLSVDESAVVTIPSDASTDSDASDEQKLEFKKTHGNENLSTPAVRSLAKQHGIDLDDVIGSGKNGRILKEDVLNYGIEKGTIEDKPASFNPTSIEPMSGPEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025988`
TK1151 ID	TkA06G039310
OH-1004 ID	LXL04_025988
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025988

Location Chr05:119413198-119416207 (+)

Description Similar to BCE2: Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06850`	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025988 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009744 response to sucrose Biological Process

GO:0040019 positive regulation of embryonic development Biological Process

GO:0043617 cellular response to sucrose starvation Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0120552 branched-chain alpha-keto acid decarboxylation to branched-chain acyl-CoA Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005929 cilium Cellular Component

KEGG gene cross-reference

ath:AT3G06850

bta:280759

cel:CELE_ZK669.4

hsa:1629

mmu:13171

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.889

Rank 1 · LXL04_025988 · OH-1004

Cytoplasm0.071

Rank 2 · LXL04_025988 · OH-1004

Nucleus0.044

Rank 3 · LXL04_025988 · OH-1004

Plastid0.024

Rank 4 · LXL04_025988 · OH-1004

Peroxisome0.018

Rank 5 · LXL04_025988 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00364.29Biotin_lipoyl89-160 aa

PF02817.23E3_binding198-231 aa

PF00198.292-oxoacid_dh275-500 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025988	`PF00364.29`	Biotin_lipoyl	89	160	1.9e-17	63.5
LXL04_025988	`PF02817.23`	E3_binding	198	231	4.1e-16	59.6
LXL04_025988	`PF00198.29`	2-oxoacid_dh	275	500	4.2e-74	249.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7Z1`	Arabidopsis thaliana	Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial	62.332%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card