LXL04_025978 | RubberDandelionOmics

Gene overview

LXL04_025978

Reference: OH-1004 Chr: Chr05 Coordinates: 119335364-119339756 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · LXL04_025978|LXL04_025978|OH1004|cDNA

ATGGCGGATTCAAACGATTCTATCGCCATTGACATGGATTCAAGCTCTCCTGGTGGCAAGGCGCATATTCTCGAAACTGCCACTGGATTTATTTCTGTTGTTATTATGGGGGACCCAGATAAGCCACCTTTGATTACATATCCTGATTTGGCTTTAAATTATATGTCCTGTTTTCAAGGGCTGTTGTTATGTCCAGAAGCATTTTCTTTGTTACTTGATAATTTCTGCATTTATCATATCAGTCCTCCTGGTCATGAATT...

CDS

Download CDS FASTA

1041 bp · LXL04_025978|LXL04_025978|OH1004|CDS

ATGGCGGATTCAAACGATTCTATCGCCATTGACATGGATTCAAGCTCTCCTGGTGGCAAGGCGCATATTCTCGAAACTGCCACTGGATTTATTTCTGTTGTTATTATGGGGGACCCAGATAAGCCACCTTTGATTACATATCCTGATTTGGCTTTAAATTATATGTCCTGTTTTCAAGGGCTGTTGTTATGTCCAGAAGCATTTTCTTTGTTACTTGATAATTTCTGCATTTATCATATCAGTCCTCCTGGTCATGAATT...

Protein

Download Protein FASTA

346 aa · LXL04_025978|LXL04_025978|OH1004|PROTEIN

MADSNDSIAIDMDSSSPGGKAHILETATGFISVVIMGDPDKPPLITYPDLALNYMSCFQGLLLCPEAFSLLLDNFCIYHISPPGHELGADELTYDDVTLSADDLANQVAEVLDYFGLSSVMCLGVTAGAYVLTLFAIKYTQRVVGLILISPLCKSPSWSEWLSNKVVSKVLYYYGMCGLVKELLLSRYFSKEVRGGTVVPDSEMVYSCRRSLDEIQSVNVLRFLEALNGRSDITEGLKRVQCRSLIFVGENSPFHSESLH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025978`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025978

Location Chr05:119335364-119339756 (-)

Description Similar to NDL2: Protein NDL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11790`	Involved in a signaling pathway that modulates root auxin transport and auxin gradients.	Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557
`At5g56750`	Interacts with the heterotrimeric G protein beta subunit GB1 and plays an significant role in GB1-dependent regulation of lateral root formation.	Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557
`At2g19620`	Involved in a signaling pathway that modulates root auxin transport and auxin gradients.	Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025978 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0060918 auxin transport Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G19620

ath:AT5G11790

ath:AT5G56750

xla:447720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.470

Rank 1 · LXL04_025978 · OH-1004

Nucleus0.180

Rank 2 · LXL04_025978 · OH-1004

Golgi apparatus0.163

Rank 3 · LXL04_025978 · OH-1004

Mitochondrion0.143

Rank 4 · LXL04_025978 · OH-1004

Cell membrane0.141

Rank 5 · LXL04_025978 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03096.21Ndr22-305 aa

PF12697.14Abhydrolase_668-291 aa

PF00561.27Abhydrolase_170-195 aa

PF12146.16Hydrolase_494-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025978	`PF03096.21`	Ndr	22	305	1.6e-101	339.5
LXL04_025978	`PF12697.14`	Abhydrolase_6	68	291	2.3e-06	29.1
LXL04_025978	`PF00561.27`	Abhydrolase_1	70	195	9e-07	29.5
LXL04_025978	`PF12146.16`	Hydrolase_4	94	254	1.5e-07	31.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASU8`	Arabidopsis thaliana	Protein NDL2	69.006%	Swiss-Prot	strong database homology
`Q9FJT7`	Arabidopsis thaliana	Protein NDL1	64.620%	Swiss-Prot	strong database homology
`Q9ZUN1`	Arabidopsis thaliana	Protein NDL3	62.209%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card