LXL04_025959 | RubberDandelionOmics

Gene overview

LXL04_025959

Reference: OH-1004 Chr: Chr05 Coordinates: 119065354-119067141 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1473 bp · LXL04_025959|LXL04_025959|OH1004|cDNA

ATGCACTGGGCCCACTCCGTATCACACGATTTAATAAACTGGACCCATCTTCAACCAGCCCTCGCTCCAACCGACCCGTTCGACATGAATGGCTGCTGGTCCGGCTCCGCCTCCATCCTCCCGGGAAATAAACCCATTATGCTTTACACCGGAAGAGACTCCGAAGAACGTCAAGTCCAGAATTTGGCCGTTCCAAAGGACTTATCCGATCCCTATCTTAAACAATGGGTCAAACACTCCGGCAATCCAGTCATAAACCT...

CDS

Download CDS FASTA

1473 bp · LXL04_025959|LXL04_025959|OH1004|CDS

ATGCACTGGGCCCACTCCGTATCACACGATTTAATAAACTGGACCCATCTTCAACCAGCCCTCGCTCCAACCGACCCGTTCGACATGAATGGCTGCTGGTCCGGCTCCGCCTCCATCCTCCCGGGAAATAAACCCATTATGCTTTACACCGGAAGAGACTCCGAAGAACGTCAAGTCCAGAATTTGGCCGTTCCAAAGGACTTATCCGATCCCTATCTTAAACAATGGGTCAAACACTCCGGCAATCCAGTCATAAACCT...

Protein

Download Protein FASTA

490 aa · LXL04_025959|LXL04_025959|OH1004|PROTEIN

MHWAHSVSHDLINWTHLQPALAPTDPFDMNGCWSGSASILPGNKPIMLYTGRDSEERQVQNLAVPKDLSDPYLKQWVKHSGNPVINLPEGIKPDDFRDPTTVWLEEDGKWRLLVGSQKDKKGIVFVYRSDDFVNWSKFDSPFHEAPGTGIWECPDFFPVLVDGTNGVDTSVVSPRNGVKHVLKVGLLDTFKDYYMIGSYSPEIEEYVPEIEFTFSSLRLDYGCYYAAKSFFDPIKNRRIMMAWVHESDSKADAFVKGWSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025959`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025959

Location Chr05:119065354-119067141 (-)

Description Similar to CWINV3: Beta-fructofuranosidase, insoluble isoenzyme CWINV3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55120`	6-fructan exohydrolase that can use phlein, levan, neokestose, levanbiose, 6-kestose, and 1-kestose as substrates.	No verified direct reference in this release
`At3g13790`	Beta-fructofuranosidase that can use sucrose and 1-kestose, and, to a lower extent, neokestose and levan, as substrates, but not inuline.	Unraveling the difference between invertases and fructan exohydrolases: a single amino acid (Asp-239) substitution transforms Arabidopsis cell wall invertase1 into a fructan 1-exohydrolase.2007 · DOI: 10.1104/pp.107.105049

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YZ01`	May play a role in sucrose partitioning during seed development.	No verified direct reference in this release
`Os09g0255000`	May play a role in sucrose partitioning during seed development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025959 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004564 beta-fructofuranosidase activity Molecular Function

GO:0033949 fructan beta-(2,6)-fructosidase activity Molecular Function

KEGG gene cross-reference

ag:CAD48404

ath:AT1G55120

ath:AT3G13790

dosa:Os09g0255000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.333

Rank 1 · LXL04_025959 · OH-1004

Cytoplasm0.223

Rank 2 · LXL04_025959 · OH-1004

Endoplasmic reticulum0.213

Rank 3 · LXL04_025959 · OH-1004

Extracellular0.148

Rank 4 · LXL04_025959 · OH-1004

Cell membrane0.093

Rank 5 · LXL04_025959 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00251.27Glyco_hydro_32N1-281 aa

PF08244.20Glyco_hydro_32C285-479 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025959	`PF00251.27`	Glyco_hydro_32N	1	281	8.6e-79	266.0
LXL04_025959	`PF08244.20`	Glyco_hydro_32C	285	479	2.1e-22	80.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67XZ3`	Arabidopsis thaliana	Beta-fructofuranosidase, insoluble isoenzyme CWINV3	54.251%	Swiss-Prot	strong database homology
`Q43866`	Arabidopsis thaliana	Beta-fructofuranosidase, insoluble isoenzyme CWINV1	53.455%	Swiss-Prot	strong database homology
`A2YZ01`	Oryza sativa subsp. indica	Beta-fructofuranosidase, insoluble isoenzyme 7	51.111%	Swiss-Prot	strong database homology
`Q0J360`	Oryza sativa subsp. japonica	Beta-fructofuranosidase, insoluble isoenzyme 7	50.909%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card